8SHF: CCT-G beta 5 complex closed state 7

Name: PDB 8SHF: CCT-G beta 5 complex closed state 7
Published: 2023-11-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

CCT-G beta 5 complex closed state 7. Determined by electron microscopy at 3.0 Å resolution. Released 1 Nov 2023.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 18
Atoms: 67,730
Mol. weight: 1013.55 kDa
Ligands: AF3, MG, ADP
Released: 1 Nov 2023

Explore 8SHF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SHF contains 394 α-helices and 421 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 24 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	70
α-helix	15-32	18
α-helix	33-35	3
β-strand	42-46	5	71
β-strand	52-55	4	71
α-helix	58-64	7
β-strand	67	1	72
α-helix	70-85	16
α-helix	90-109	20
α-helix	114-135	22
β-strand	138-139	2	73
α-helix	145-156	12
α-helix	165-178	14
β-strand	181-182	2	74
α-helix	184-186	3
β-strand	188-189	2	74
β-strand	196-201	6	75
α-helix	205-207	3
β-strand	209-211	3	75
β-strand	213-216	4	76
β-strand	228-229	2	76
β-strand	232-237	6	76
β-strand	241	1	77
β-strand	250-254	5	78
α-helix	257-259	3
α-helix	260-279	20
β-strand	285-288	4	76
β-strand	292	1	77
α-helix	294-303	10
β-strand	308	1	76
α-helix	313-323	11
β-strand	328	1	76
α-helix	342-344	3
β-strand	346-356	11	76
β-strand	359-367	9	76
β-strand	374-379	6	75
α-helix	382-404	23
β-strand	407-410	4	73
α-helix	414-426	13
α-helix	427-429	3
α-helix	434-444	11
α-helix	447-455	9
α-helix	460-476	17
α-helix	478-485	8
β-strand	486-489	4	79
β-strand	494-497	4	79
α-helix	498-501	4
β-strand	504-506	3	73
α-helix	507-525	19
β-strand	527-533	7	70

Chain A: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	4
β-strand	9-13	5	5
α-helix	15-32	18
α-helix	33-35	3
β-strand	42	1	6
β-strand	43-44	2	7
β-strand	45-46	2	8
β-strand	54-55	2	7
α-helix	58-64	7
β-strand	67	1	9
α-helix	70-85	16
α-helix	90-109	20
α-helix	114-131	18
α-helix	132-136	5
β-strand	138-139	2	10
α-helix	140-142	3
α-helix	145-156	12
α-helix	165-178	14
β-strand	181-182	2	11
α-helix	184-186	3
β-strand	188-189	2	11
β-strand	196-199	4	12
α-helix	205-207	3
β-strand	209-211	3	12
β-strand	213-216	4	13
β-strand	228-229	2	13
β-strand	232-237	6	13
β-strand	241	1	14
β-strand	250-254	5	15
α-helix	257-259	3
α-helix	260-280	21
β-strand	285-288	4	13
β-strand	292	1	14
α-helix	294-303	10
β-strand	306-308	3	13
α-helix	313-323	11
β-strand	328	1	13
α-helix	342-344	3
β-strand	346-356	11	13
β-strand	359-367	9	13
β-strand	374-377	4	12
α-helix	382-404	23
β-strand	407-410	4	10
α-helix	414-426	13
α-helix	427-429	3
α-helix	433-444	12
α-helix	447-455	9
α-helix	460-476	17
α-helix	478-485	8
β-strand	486-489	4	16
β-strand	494-497	4	16
α-helix	498-501	4
β-strand	504-506	3	10
α-helix	507-525	19
β-strand	527-533	7	5
α-helix	534-535	2

Chain b: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	80
α-helix	21-39	19
β-strand	49-53	5	81
β-strand	61-64	4	81
α-helix	67-72	6
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-144	22
β-strand	146-147	2	82
α-helix	152-168	17
α-helix	171-175	5
α-helix	176-188	13
α-helix	196-198	3
β-strand	199-205	7	83
α-helix	209-211	3
β-strand	213-214	2	83
β-strand	218-220	3	84
β-strand	232-240	9	84
β-strand	254-258	5	78
α-helix	261-283	23
β-strand	289-292	4	84
α-helix	298-306	9
β-strand	310-312	3	84
α-helix	317-327	11
β-strand	332	1	84
α-helix	338-340	3
β-strand	344-354	11	84
β-strand	357-365	9	84
β-strand	371-377	7	83
α-helix	380-402	23
β-strand	405-408	4	82
α-helix	412-425	14
α-helix	432-454	23
α-helix	458-471	14
β-strand	476-479	4	85
β-strand	484-487	4	85
α-helix	488-491	4
β-strand	494-496	3	82
α-helix	497-515	19
β-strand	517-522	6	80
α-helix	523-525	3

Chain B: 21 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	17
α-helix	21-39	19
β-strand	49-53	5	18
β-strand	61-64	4	18
α-helix	67-72	6
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-144	22
β-strand	146-147	2	19
α-helix	152-168	17
α-helix	171-175	5
α-helix	176-188	13
α-helix	196-198	3
β-strand	199-206	8	20
α-helix	209-211	3
β-strand	213-214	2	20
β-strand	218-220	3	21
β-strand	224	1	21
β-strand	231-240	10	21
β-strand	254-258	5	15
α-helix	261-283	23
β-strand	289-292	4	21
α-helix	298-307	10
β-strand	310-312	3	21
α-helix	317-327	11
β-strand	332	1	21
α-helix	338-340	3
β-strand	344-354	11	21
β-strand	357-365	9	21
β-strand	371-377	7	20
α-helix	380-402	23
β-strand	405-408	4	19
α-helix	412-425	14
α-helix	432-452	21
α-helix	458-471	14
β-strand	476-479	4	22
β-strand	484-487	4	22
α-helix	488-491	4
β-strand	494-496	3	19
α-helix	497-515	19
β-strand	517-522	6	17
α-helix	523-525	3

Chain d: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	29-47	19
β-strand	58-62	5	70
β-strand	68-71	4	70
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-125	20
α-helix	132-151	20
β-strand	153-154	2	86
α-helix	160-171	12
α-helix	175-177	3
α-helix	180-193	14
α-helix	205-207	3
β-strand	208-215	8	87
α-helix	218-220	3
β-strand	222	1	87
β-strand	227-229	3	88
α-helix	232-233	2
β-strand	241-249	9	88
β-strand	253	1	89
β-strand	262-266	5	78
α-helix	269-291	23
β-strand	297-301	5	88
β-strand	309	1	89
α-helix	311-319	9
β-strand	323-328	6	88
α-helix	330-332	3
α-helix	333-340	8
β-strand	345	1	88
α-helix	348-350	3
α-helix	353-355	3
β-strand	357-366	10	88
β-strand	372-379	8	88
β-strand	386-392	7	87
α-helix	395-416	22
β-strand	420-423	4	86
α-helix	427-441	15
α-helix	446-458	13
α-helix	460-466	7
α-helix	473-486	14
β-strand	491-494	4	90
β-strand	499-502	4	90
α-helix	504-506	3
β-strand	509-511	3	86
α-helix	512-530	19
β-strand	532-537	6	81

Chain D: 25 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	29-49	21
α-helix	56-57	2
β-strand	58-62	5	5
β-strand	68-71	4	5
α-helix	74-80	7
β-strand	83	1	4
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-150	21
β-strand	153-154	2	23
α-helix	160-172	13
α-helix	180-192	13
α-helix	205-207	3
β-strand	208-215	8	24
α-helix	218-220	3
β-strand	222-224	3	24
β-strand	227-229	3	25
α-helix	231-232	2
β-strand	233	1	26
β-strand	240-242	3	25
β-strand	245-249	5	26
β-strand	253	1	27
β-strand	262-266	5	15
α-helix	269-291	23
β-strand	297-301	5	26
β-strand	309	1	27
α-helix	311-319	9
β-strand	323-328	6	26
α-helix	330-332	3
α-helix	333-340	8
α-helix	342-344	3
β-strand	345	1	26
α-helix	348-350	3
α-helix	353-355	3
β-strand	357-358	2	26
β-strand	359-366	8	25
β-strand	372-379	8	25
β-strand	386-392	7	24
α-helix	395-417	23
β-strand	420-423	4	23
α-helix	427-440	14
α-helix	447-458	12
α-helix	460-469	10
α-helix	473-486	14
β-strand	491-494	4	28
β-strand	499-502	4	28
α-helix	503-506	4
β-strand	509-511	3	23
α-helix	512-531	20
β-strand	532-537	6	18

Chain e: 23 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	91
β-strand	26-29	4	92
α-helix	31-48	18
α-helix	49-51	3
β-strand	58-62	5	80
β-strand	68-71	4	80
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-150	21
β-strand	153-154	2	93
α-helix	163-173	11
α-helix	177-181	5
α-helix	182-195	14
α-helix	206-208	3
β-strand	209-216	8	94
α-helix	219-221	3
β-strand	223-225	3	94
β-strand	228-230	3	95
β-strand	234	1	96
β-strand	242-248	7	95
β-strand	250	1	96
β-strand	251	1	97
β-strand	255	1	98
β-strand	263-268	6	78
α-helix	271-294	24
β-strand	300-301	2	96
β-strand	306	1	98
α-helix	308-316	9
β-strand	321-322	2	96
α-helix	327-337	11
β-strand	342	1	97
α-helix	345-347	3
α-helix	350-352	3
β-strand	354-363	10	95
β-strand	370-375	6	95
β-strand	383-389	7	94
α-helix	392-414	23
β-strand	417-420	4	93
α-helix	424-439	16
α-helix	442-455	14
α-helix	457-465	9
α-helix	470-483	14
β-strand	489	1	99
β-strand	500	1	99
α-helix	501-504	4
β-strand	507-509	3	93
α-helix	510-529	20
β-strand	530-535	6	92

Chain E: 23 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	29
α-helix	22-24	3
β-strand	28-29	2	30
α-helix	31-48	18
α-helix	49-51	3
β-strand	58-62	5	17
β-strand	68-71	4	17
α-helix	74-80	7
α-helix	86-101	16
α-helix	108-125	18
α-helix	130-151	22
β-strand	153-154	2	31
α-helix	163-173	11
α-helix	177-180	4
α-helix	182-195	14
α-helix	206-208	3
β-strand	209-216	8	32
α-helix	219-221	3
β-strand	223-225	3	32
β-strand	228-230	3	33
β-strand	234	1	33
β-strand	242-250	9	33
β-strand	251	1	34
β-strand	255	1	35
β-strand	264-268	5	15
α-helix	271-294	24
β-strand	299-301	3	33
β-strand	306	1	35
α-helix	308-316	9
β-strand	321-322	2	33
α-helix	327-337	11
β-strand	342	1	34
α-helix	345-347	3
α-helix	350-352	3
β-strand	354-363	10	33
β-strand	370-375	6	33
β-strand	383-389	7	32
α-helix	392-414	23
β-strand	417-420	4	31
α-helix	424-439	16
α-helix	442-455	14
α-helix	457-465	9
α-helix	470-483	14
β-strand	489	1	36
β-strand	500	1	36
β-strand	507-509	3	31
α-helix	510-528	19
β-strand	530-534	5	30

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein subunit beta-5	N	protein	395	Homo sapiens	O14775 (AlphaFold model)
T-complex protein 1 subunit alpha	A, a	protein	536	Homo sapiens	P17987 (AlphaFold model)
T-complex protein 1 subunit beta	B, b	protein	526	Homo sapiens	P78371 (AlphaFold model)
T-complex protein 1 subunit delta	D, d	protein	520	Homo sapiens	P50991 (AlphaFold model)
T-complex protein 1 subunit epsilon	E, e	protein	540	Homo sapiens	P48643
T-complex protein 1 subunit gamma	G, g	protein	528	Homo sapiens	P49368
T-complex protein 1 subunit eta, N-terminally processed	H, h	protein	528	Homo sapiens	Q99832
T-complex protein 1 subunit theta	Q, q	protein	538	Homo sapiens	P50990
T-complex protein 1 subunit zeta	Z, z	protein	527	Homo sapiens	P40227
Phosducin-like protein	P	protein	301	Homo sapiens	Q13371

Sequence of entity 1 (N), FASTA

>8SHF_1 Guanine nucleotide-binding protein subunit beta-5 (chains N)
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA

Sequence of entity 2 (A, a), FASTA

>8SHF_2 T-complex protein 1 subunit alpha (chains A, a)
EGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATI
LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY
RLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKY
TDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSL
QKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFV
EAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDEL
ILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSI
YLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK
NLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPES

Sequence of entity 3 (B, b), FASTA

>8SHF_3 T-complex protein 1 subunit beta (chains B, b)
ASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASL
MVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKI
HPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTK
LAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIAN
TGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPE
QLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIH
FSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAV
TQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMR
EGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRK

Sequence of entity 4 (D, d), FASTA

>8SHF_4 T-complex protein 1 subunit delta (chains D, d)
RGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATIL
KQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQ
KALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPA
TATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKT
DMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLN
KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG
CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE
YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG
GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNT

Sequence of entity 5 (E, e), FASTA

>8SHF_5 T-complex protein 1 subunit epsilon (chains E, e)
ASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMM
VDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAE
QLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSC
HRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPK
KVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAI
CQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQE
ISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYG
GGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQ
VKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Sequence of entity 6 (G, g), FASTA

>8SHF_6 T-complex protein 1 subunit gamma (chains G, g)
GHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTND
GNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVV
ISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKM
VQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLD
SSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQH
YLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTF
ITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHAL
TEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNG
ETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKG

Sequence of entity 7 (H, h), FASTA

>8SHF_7 T-complex protein 1 subunit eta, N-terminally processed (chains H, h)
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD

Sequence of entity 8 (Q, q), FASTA

>8SHF_8 T-complex protein 1 subunit theta (chains Q, q)
ALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLE
KLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRI
GLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAK
LIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAV
YSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMA
LHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVV
VFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAK
QITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLD
IEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGK

Sequence of entity 9 (Z, z), FASTA

>8SHF_9 T-complex protein 1 subunit zeta (chains Z, z)
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMS

Sequence of entity 10 (P), FASTA

>8SHF_10 Phosducin-like protein (chains P)
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPK
GVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMT
LKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKS
IVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYK
GGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEI
D

Ligands and cofactors

ID	Name	Formula	Copies
AF3	Aluminum fluoride	Al F3	16
MG	Magnesium ion	Mg	16
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	16

Primary citation

Visualizing the chaperone-mediated folding trajectory of the G protein beta 5 beta-propeller. Wang, S., Sass, M.I., Kwon, Y. et al. Mol Cell (2023) 83:3852-3868.e6. DOI 10.1016/j.molcel.2023.09.032 · PubMed

Other PDB entries of the same protein (UniProt O14775 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SH9 2.7 Å, CCT G beta 5 complex best PhLP1 class
8SHE 2.8 Å, CCT-G beta 5 complex closed state 8
8SHG 2.8 Å, CCT G beta 5 complex closed state 9
8SHN 2.8 Å, CCT-G beta 5 complex closed state 6
8SG9 2.9 Å, CCT G beta 5 complex closed state 3
8SGC 2.9 Å, CCT G beta 5 complex closed state 2
8SGL 2.9 Å, CCT G beta 5 complex closed state 15
8SHD 2.9 Å, CCT G beta 5 complex closed state 10
8SHQ 2.9 Å, CCT G beta 5 complex closed state 12
9NOQ 2.9 Å, CCT G beta 5 R269E complex state 5
9NRH 2.9 Å, CCT G beta 5 R269E complex state 4
8SG8 3.0 Å, CCT G beta 5 complex closed state 1

Browse structure collections

About this viewer

MolViewer shows 8SHF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.