8SRX: BAK-BAX heterodimer with lysoPC

Crystal structure of BAK-BAX heterodimer with lysoPC. Determined by X-ray diffraction at 2.09 Å resolution. Released 27 Dec 2023.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,708
Mol. weight: 39.28 kDa
Ligands: ZN, K6G
Released: 27 Dec 2023

Explore 8SRX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SRX contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	73-88	16
α-helix	90-96	7
α-helix	104-120	17
α-helix	125-145	21

Chains B and D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	57-72	16
α-helix	74-82	9
α-helix	88-98	11
α-helix	107-125	19

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	73-88	16
α-helix	90-97	8
α-helix	104-120	17
α-helix	125-142	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A, C	protein	91	Homo sapiens	Q16611 (AlphaFold model)
Apoptosis regulator BAX	B, D	protein	80	Homo sapiens	Q07812 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>8SRX_1 Bcl-2 homologous antagonist/killer (chains A, C)
GPLGSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGI
NWGRVVALLGFGYRLALHVYQHGGSGGSGGS

Sequence of entity 2 (B, D), FASTA

>8SRX_2 Apoptosis regulator BAX (chains B, D)
GGSGDASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWG
RVVALFYFASKLVLKALSTK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
K6G	[(2~{R})-2-oxidanyl-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]o…	C24 H51 N O7 P	3

Water and common crystallization additives (CL, EDO, PEG, NA) are not listed.

Primary citation

Sequence differences between BAX and BAK core domains manifest as differences in their interactions with lipids. Miller, M.S., Cowan, A.D., Brouwer, J.M. et al. FEBS J (2024) 291:2335-2353. DOI 10.1111/febs.17031 · PubMed

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
9CPE 1.49 Å, Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
5FMI 1.49 Å, Human Bak Q77L
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4

Browse structure collections

About this viewer

MolViewer shows 8SRX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.