8SUV: CHIP-TPR

Name: PDB 8SUV: CHIP-TPR in complex with the C-terminus of CHIC2
Published: 2024-03-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

CHIP-TPR in complex with the C-terminus of CHIC2. Determined by X-ray diffraction at 1.63 Å resolution. Released 20 Mar 2024.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,819
Mol. weight: 69.77 kDa
Released: 20 Mar 2024

Explore 8SUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SUV contains 28 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
α-helix	134-148	15

Chains B and D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
α-helix	134-149	16

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-127	18
α-helix	134-149	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CHIP	A, B, C, D	protein	139	Homo sapiens	Q9UNE7 (AlphaFold model)
Cysteine-rich hydrophobic domain-containing protein 2	F, G, H, I	protein	12	Homo sapiens	Q9UKJ5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8SUV_1 E3 ubiquitin-protein ligase CHIP (chains A, B, C, D)
GAMGSEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQ
HEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDI
PSALRIAKKKRWNSIEERR

Sequence of entity 2 (F, G, H, I), FASTA

>8SUV_2 Cysteine-rich hydrophobic domain-containing protein 2 (chains F, G, H, I)
EFLPKTPIFRPD

Primary citation

Interaction with the membrane-anchored protein CHIC2 constrains the ubiquitin ligase activity of CHIP. Callahan, M., Hodul, M., Carroll, E. et al. bioRxiv (2023). DOI 10.1101/2023.07.17.549407

Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QFY 1.06 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9.
6NSV 1.3 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated…
9QFS 1.33 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8.
9QEU 1.35 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
8EI0 1.47 Å, Crystal structure of the STUB1 TPR domain in complex with H318, a Helicon Polypeptide
6EFK 1.5 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated HSP70…
9QF1 1.51 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2
8F16 1.56 Å, Structure of the STUB1 TPR domain in complex with H203, an all-D Helicon Polypeptide
9DYB 1.6 Å, CHIP-TPR in complex with the phosphorylated Hsp70 tail
8F14 1.69 Å, Structure of the STUB1 TPR domain in complex with H201, an all-D Helicon Polypeptide
8F15 1.73 Å, Structure of the STUB1 TPR domain in complex with H202, an all-D Helicon Polypeptide

Browse structure collections

About this viewer

MolViewer shows 8SUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.