Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with a Y270E mutation. Determined by X-ray diffraction at 2.14 Å resolution. Released 30 Oct 2024.
Explore 8T0A in 3D Show helices and sheets RCSB PDB PDBe
8T0A contains 20 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| β-strand | 24 | 1 | 2 |
| α-helix | 25-35 | 11 | |
| α-helix | 37-40 | 4 | |
| α-helix | 44-46 | 3 | |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-61 | 2 | 1 |
| α-helix | 62-63 | 2 | |
| β-strand | 67 | 1 | 2 |
| α-helix | 68-71 | 4 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 85-91 | 7 | 3 |
| β-strand | 97-103 | 7 | 3 |
| α-helix | 108-118 | 11 | |
| α-helix | 124-126 | 3 | |
| β-strand | 127-131 | 5 | 3 |
| α-helix | 181-183 | 3 | |
| β-strand | 191-195 | 5 | 3 |
| α-helix | 196-197 | 2 | |
| α-helix | 199-201 | 3 | |
| α-helix | 209-224 | 16 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 274-284 | 11 | |
| α-helix | 291-303 | 13 | |
| β-strand | 311-317 | 7 | 4 |
| β-strand | 326-332 | 7 | 4 |
| β-strand | 336-340 | 5 | 4 |
| β-strand | 347-352 | 6 | 4 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-361 | 4 | 4 |
| β-strand | 365-369 | 5 | 4 |
| α-helix | 371-373 | 3 | |
| β-strand | 378-381 | 4 | 4 |
| α-helix | 385-401 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin beta-2,Talin-1 | A | protein | 411 | Mus musculus | P11835 (AlphaFold model), P26039 (AlphaFold model) |
>8T0A_1 Integrin beta-2,Talin-1 (chains A) MNNDNPLFKSAMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGL FLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVT DMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFY SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGF LDLKDFLPKEEVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKM KGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYS VQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKST
Crystal structure of beta-2 in complex with talin in a FERM configuration. Wu, J., Gao, T. To be published.
Other PDB entries of the same protein (UniProt P11835 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8T0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.