NMR Assignments and Structure for the Dimeric Kinesin Neck Domain. Determined by solution NMR. Released 1 Nov 2023.
Explore 8TT7 in 3D Show helices and sheets RCSB PDB PDBe
8TT7 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-12 | 3 | |
| α-helix | 17-49 | 33 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinesin heavy chain isoform 5C | A, B | protein | 54 | Rattus norvegicus | P56536 (AlphaFold model) |
>8TT7_1 Kinesin heavy chain isoform 5C (chains A, B) GSKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV
Solution NMR assignments and structure for the dimeric kinesin neck domain. Seo, D., Kammerer, R.A., Alexandrescu, A.T. Biomol NMR Assign (2023) 17:301-307. DOI 10.1007/s12104-023-10159-x · PubMed
Other PDB entries of the same protein (UniProt P56536 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8TT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.