Unphosphorylated CaMKK2 in complex with CC-8977. Determined by X-ray diffraction at 1.5 Å resolution. Released 13 Dec 2023.
Explore 8TUC in 3D Show helices and sheets RCSB PDB PDBe
8TUC contains 16 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 160-162 | 3 | 1 |
| β-strand | 165-172 | 8 | 1 |
| β-strand | 178-184 | 7 | 1 |
| β-strand | 189-197 | 9 | 1 |
| α-helix | 198-204 | 7 | |
| α-helix | 224-226 | 3 | |
| α-helix | 231-242 | 12 | |
| β-strand | 248 | 1 | 2 |
| β-strand | 251-255 | 5 | 1 |
| β-strand | 262-268 | 7 | 1 |
| β-strand | 273-274 | 2 | 2 |
| α-helix | 283-285 | 3 | |
| α-helix | 286-305 | 20 | |
| β-strand | 308-309 | 2 | 3 |
| α-helix | 315-317 | 3 | |
| β-strand | 318-320 | 3 | 2 |
| α-helix | 321 | 1 | |
| β-strand | 326-328 | 3 | 2 |
| β-strand | 335-336 | 2 | 3 |
| β-strand | 343-344 | 2 | 4 |
| α-helix | 351-353 | 3 | |
| α-helix | 356-358 | 3 | |
| β-strand | 366-367 | 2 | 4 |
| α-helix | 368-385 | 18 | |
| α-helix | 395-404 | 10 | |
| α-helix | 405-407 | 3 | |
| α-helix | 417-426 | 10 | |
| α-helix | 435-436 | 2 | |
| α-helix | 437-440 | 4 | |
| α-helix | 444-447 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase kinase 2 | A | protein | 291 | Homo sapiens | Q96RR4 (AlphaFold model) |
>8TUC_1 Calcium/calmodulin-dependent protein kinase kinase 2 (chains A) SMQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRP APGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEV PTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFK GSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCL HSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRH
| ID | Name | Formula | Copies |
|---|---|---|---|
| O7I | (4M)-2-cyclopentyl-4-(7-ethoxyquinazolin-4-yl)benzoic acid | C22 H22 N2 O3 | 1 |
Water and common crystallization additives (SO4, EDO) are not listed.
Identification of Small Molecule Inhibitors and Ligand Directed Degraders of Calcium/Calmodulin Dependent Protein Kinase Kinase 1 and 2 (CaMKK1/2). Chen, Y., Whitefield, B., Nevius, E. et al. J Med Chem (2023) 66:15750-15760. DOI 10.1021/acs.jmedchem.3c01137 · PubMed
Other PDB entries of the same protein (UniProt Q96RR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8TUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.