8TWI: PP2A:B55-FAM122A complex, PP2Ac body

Cryo-EM structure of the PP2A:B55-FAM122A complex, PP2Ac body. Determined by electron microscopy at 2.69 Å resolution. Released 1 Nov 2023.

Method: Electron microscopy
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,073
Mol. weight: 111.61 kDa
Ligands: ZN, FE
Released: 1 Nov 2023

Explore 8TWI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8TWI contains 36 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	397-412	16
α-helix	417-434	18
α-helix	436-438	3
α-helix	439-443	5
α-helix	444-451	8
α-helix	456-477	22
α-helix	478-482	5
α-helix	483-488	6
α-helix	489-491	3
α-helix	495-516	22
α-helix	517-521	5
α-helix	522-527	6
α-helix	528-530	3
α-helix	534-547	14
α-helix	548-550	3
α-helix	553-555	3
α-helix	556-560	5
α-helix	561-568	8
α-helix	573-586	14

Chain C: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16
α-helix	22-24	3
α-helix	25-39	15
β-strand	45-48	4	1
α-helix	49	1
β-strand	52-55	4	2
α-helix	62-72	11
β-strand	80-82	3	2
α-helix	93-106	14
β-strand	111-113	3	2
α-helix	121-127	7
α-helix	129-137	9
α-helix	141-150	10
β-strand	156-159	4	1
β-strand	163-166	4	1
α-helix	177-181	5
α-helix	189-190	2
α-helix	194-200	7
β-strand	202-203	2	3
β-strand	209-211	3	3
β-strand	218-220	3	3
α-helix	222-232	11
β-strand	236-239	4	1
β-strand	248-251	4	1
β-strand	256-259	4	1
α-helix	265-267	3
β-strand	273-278	6	2
α-helix	279	1
β-strand	284-289	6	2
α-helix	290-294	5

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	96-110	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform	A	protein	584	Homo sapiens	P30153 (AlphaFold model)
Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform	C	protein	311	Homo sapiens	P67775 (AlphaFold model)
PPP2R1A-PPP2R2A-interacting phosphatase regulator 1	D	protein	95	Homo sapiens	Q96E09 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8TWI_1 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (chains A)
GHMSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEV
LLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLE
AHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAA
ASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVM
PTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHK
VKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL
LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIE
YMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPK
VLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQ
KIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

Sequence of entity 2 (C), FASTA

>8TWI_2 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (chains C)
GHMDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDV
HGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNH
ESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLD
HIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVS
RAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEP
HVTRRTPDYFL

Sequence of entity 3 (D), FASTA

>8TWI_3 PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 (chains D)
GHMGGGLRRSNSAPLIHGLSDSSPVFQDEAPSARRNRTTFPSRHGLLLPASPVRMHSSRL
HQIKQEEGMDLINRETVHEREVQTAMQISHSWEES

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
FE	FE (III) ion	Fe	1

Primary citation

Cryo-EM structures of PP2A:B55-FAM122A and PP2A:B55-ARPP19. Padi, S.K.R., Vos, M.R., Godek, R.J. et al. Nature (2024) 625:195-203. DOI 10.1038/s41586-023-06870-3 · PubMed

Other PDB entries of the same protein (UniProt P30153 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B3U 2.3 Å, Crystal structure of constant regulatory domain of human PP2A, PR65ALPHA
4I5L 2.43 Å, Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6…
8TWE 2.55 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex, B55 body
2IE4 2.6 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to okadaic acid
9C6B 2.6 Å, PP2A:B55-p107 substrate complex
8U1X 2.7 Å, The structure of the PP2A-B56Delta holoenzyme mutant - E197K
9C7T 2.7 Å, PP2A:B55-Eya3 substrate complex
8TTB 2.77 Å, Cryo-EM structure of the PP2A:B55-ARPP19 complex
8SO0 2.8 Å, Cryo-EM structure of the PP2A:B55-FAM122A complex
2IE3 2.8 Å, Structure of the Protein Phosphatase 2A Core Enzyme Bound to Tumor-inducing Toxins
3C5W 2.8 Å, Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme
4I5N 2.8 Å, Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6…

Browse structure collections

About this viewer

MolViewer shows 8TWI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.