8U85: Human NOX5 Activation

Structural Basis of Human NOX5 Activation. Determined by electron microscopy at 3.2 Å resolution. Released 1 May 2024.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,203
Mol. weight: 172.79 kDa
Ligands: ZN, PX2, FAD, NDP
Released: 1 May 2024

Explore 8U85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8U85 contains 60 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 29 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	5-17	13
α-helix	29-35	7
α-helix	42-51	10
α-helix	61-72	12
α-helix	76-87	12
α-helix	97-106	10
α-helix	117-131	15
α-helix	141-150	10
α-helix	154-157	4
α-helix	183-213	31
α-helix	221-240	20
α-helix	247-250	4
α-helix	255-258	4
α-helix	264-294	31
α-helix	323-337	15
α-helix	341-345	5
α-helix	351-356	6
α-helix	359-367	9
α-helix	373-390	18
β-strand	397-398	2	1
β-strand	401	1	2
β-strand	402-408	7	3
β-strand	412-418	7	3
α-helix	419-420	2
β-strand	430-433	4	1
β-strand	444-447	4	1
β-strand	448	1	3
β-strand	457-463	7	3
α-helix	467-478	12
β-strand	518	1	2
β-strand	521-525	5	1
α-helix	530-533	4
β-strand	538-543	6	4
α-helix	548-563	16
β-strand	565-566	2	5
β-strand	575-576	2	5
β-strand	588-593	6	4
α-helix	601-613	13
β-strand	624-629	6	4
α-helix	640-649	10
α-helix	657-659	3
α-helix	661-664	4
β-strand	667-668	2	4
α-helix	674-683	10
β-strand	690-694	5	4
α-helix	697-710	14
β-strand	715-716	2	4

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NADPH oxidase 5	A, C	protein	719	Homo sapiens	Q96PH1 (AlphaFold model)
Ala-ala-ala-ala-ala-ala-ala-ala-ala-ala-ala-ala-ala	B, D	protein	13	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>8U85_1 NADPH oxidase 5 (chains A, C)
MSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFDSDRSGTIT
LQELQEALTLLIHGSPMDKLKFLFQVYDIDGSGSIDPDELRTVLQSCLRESAISLPDEKL
DQLTLALFESADADGNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPRQ
LTRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAV
LMLRRCLTWLRATWLAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASP
FQFWELLLTTRPGIGWVHGSASPTGVALLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYL
LVWLLLIFHGPNFWKWLLVPGILFFLEKAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRP
PFFHYRPGDYLYLNIPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKASD
PLGRGSKRLSRSVTMRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVL
IGAGIGITPFASILQSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSF
EWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSI
TGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF

Sequence of entity 2 (B, D), FASTA

>8U85_2 ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA-ALA (chains B, D)
AAAAAAAAAAAAA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
PX2	1,2-dilauroyl-sn-glycero-3-phosphate	C27 H52 O8 P	2
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2
NDP	NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate	C21 H30 N7 O17 P3	2
HEB	Heme b/c	C34 H34 Fe N4 O4	4

Primary citation

Structural basis of human NOX5 activation. Cui, C., Jiang, M., Jain, N. et al. Nat Commun (2024) 15:3994-3994. DOI 10.1038/s41467-024-48467-y · PubMed

Other PDB entries of the same protein (UniProt Q96PH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SZ5 2.23 Å, Human calmodulin bound to a peptide of human NADPH oxidase 5
8U86 3.3 Å, Structural Basis of Human NOX5 Activation
8U87 3.86 Å, Structural Basis of Human NOX5 Activation
8U7Y 4.06 Å, Structural Basis of Human NOX5 Activation

Browse structure collections

About this viewer

MolViewer shows 8U85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.