8UQN: PLCb3-Gaq complex on membranes

PLCb3-Gaq complex on membranes. Determined by electron microscopy at 3.4 Å resolution. Released 6 Dec 2023.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,550
Mol. weight: 181.39 kDa
Ligands: CA, MG, ALF, GDP
Released: 6 Dec 2023

Explore 8UQN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UQN contains 61 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
α-helix	53-62	10
α-helix	69-73	5
α-helix	76-96	21
α-helix	104-107	4
α-helix	110-113	4
α-helix	126-136	11
α-helix	139-146	8
α-helix	148-150	3
α-helix	157-160	4
α-helix	164-167	4
α-helix	176-179	4
β-strand	190-195	6	1
β-strand	200-205	6	1
α-helix	216-219	4
β-strand	225-231	7	1
α-helix	232-234	3
α-helix	237	1
β-strand	238	1	2
α-helix	239	1
β-strand	246	1	2
α-helix	248-258	11
β-strand	268-274	7	1
α-helix	278-282	5
α-helix	298	1
α-helix	304-314	11
β-strand	325-328	4	1
α-helix	335-351	17

Chain B: 41 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	26-30	5	3
β-strand	39-45	7	3
β-strand	51-54	4	3
β-strand	55	1	4
β-strand	61	1	4
α-helix	63	1
β-strand	64-65	2	3
α-helix	66-68	3
β-strand	69-74	6	3
α-helix	75-77	3
α-helix	79-81	3
α-helix	84-90	7
α-helix	98-100	3
β-strand	103-108	6	3
β-strand	116-122	7	3
α-helix	128-138	11
α-helix	142-145	4
α-helix	149-162	14
β-strand	170-171	2	5
α-helix	172-178	7
α-helix	184-192	9
β-strand	202-203	2	5
α-helix	210-216	7
α-helix	226-230	5
β-strand	241-242	2	6
α-helix	243-249	7
α-helix	250-254	5
α-helix	265-267	3
α-helix	271-273	3
α-helix	276-279	4
α-helix	283-286	4
β-strand	290-291	2	6
α-helix	293-299	7
α-helix	310-312	3
α-helix	323-325	3
β-strand	326-328	3	7
β-strand	330	1	8
β-strand	331	1	9
α-helix	348-354	7
β-strand	360-366	7	8
β-strand	376-377	2	8
β-strand	387-388	2	8
α-helix	389-398	10
β-strand	409-414	6	8
α-helix	422-432	11
α-helix	434-436	3
β-strand	437	1	10
α-helix	441-442	2
β-strand	463	1	10
β-strand	464-466	3	8
α-helix	584-586	3
β-strand	598-599	2	11
α-helix	606-610	5
β-strand	616-617	2	11
α-helix	619	1
β-strand	620-621	2	12
α-helix	622-631	10
α-helix	634-640	7
β-strand	644	1	11
β-strand	646-648	3	12
α-helix	657-660	4
α-helix	662-665	4
β-strand	671-672	2	12
β-strand	674	1	9
α-helix	681-686	6
α-helix	692-695	4
β-strand	698-700	3	7
α-helix	701-702	2
β-strand	726-736	11	13
β-strand	745-752	8	13
β-strand	762-763	2	13
α-helix	764-766	3
β-strand	775	1	13
β-strand	781-786	6	13
β-strand	793-800	8	13
β-strand	805-812	8	13
β-strand	819-826	8	13
β-strand	832-842	11	13
β-strand	845-846	2	13
α-helix	857-860	4
α-helix	862-874	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(q) subunit alpha	A	protein	355	Homo sapiens	P50148 (AlphaFold model)
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3	B	protein	1234	Homo sapiens	Q01970 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8UQN_1 Guanine nucleotide-binding protein G(q) subunit alpha (chains A)
GPMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAF
ENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRV
PTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDN
ENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQA
AREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

Sequence of entity 2 (B), FASTA

>8UQN_2 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (chains B)
GPAMDPEFMALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
MG	Magnesium ion	Mg	1
ALF	Tetrafluoroaluminate ion	Al F4	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

The mechanism of G alpha q regulation of PLC beta 3 -catalyzed PIP2 hydrolysis. Falzone, M.E., MacKinnon, R. Proc Natl Acad Sci U S A (2023) 120:e2315011120-e2315011120. DOI 10.1073/pnas.2315011120 · PubMed

Other PDB entries of the same protein (UniProt P50148 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VAW 2.24 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gq (delipidated) complex in…
9M1H 2.55 Å, Cryo-EM structure of PGE2-EP1-Gq complex
9XIX 2.58 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state
8THK 2.6 Å, Cryo-EM structure of A61603-bound alpha-1A-adrenergic receptor in complex with…
9XH2 2.6 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state
8G59 2.64 Å, Cryo-EM structure of the TUG891 bound GPR120-Giq complex
24XB 2.65 Å, Cryo-EM Structure of the Apo FFAR4-Gq Complex
8XGO 2.68 Å, a peptide receptor complex structure
9K27 2.68 Å, PrRP31 bound prolactin-releasing peptide receptor coupled with Gq protein complex
9XJP 2.74 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state, chemokine domain fully…
9LL9 2.76 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gq complex
7F6I 2.8 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and kallidin

Browse structure collections

About this viewer

MolViewer shows 8UQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.