Voltage gated potassium ion channel Kv1.2 in complex with DTx. Determined by electron microscopy at 3.2 Å resolution. Released 10 Jul 2024.
Explore 8VC3 in 3D Show helices and sheets RCSB PDB PDBe
8VC3 contains 56 α-helices and 3 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20-26 | 7 | 1 |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 47 | 1 | 1 |
| α-helix | 50-55 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-154 | 9 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-182 | 23 | |
| α-helix | 186-190 | 5 | |
| α-helix | 221-243 | 23 | |
| α-helix | 250-252 | 3 | |
| α-helix | 254-273 | 20 | |
| α-helix | 291-298 | 8 | |
| α-helix | 299-309 | 11 | |
| α-helix | 312-323 | 12 | |
| α-helix | 325-349 | 25 | |
| α-helix | 361-372 | 12 | |
| α-helix | 385-403 | 19 | |
| α-helix | 406-418 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-154 | 9 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-182 | 23 | |
| α-helix | 186-190 | 5 | |
| α-helix | 221-242 | 22 | |
| α-helix | 250-252 | 3 | |
| α-helix | 254-273 | 20 | |
| α-helix | 291-299 | 9 | |
| α-helix | 300-308 | 9 | |
| α-helix | 312-323 | 12 | |
| α-helix | 325-349 | 25 | |
| α-helix | 361-372 | 12 | |
| α-helix | 385-403 | 19 | |
| α-helix | 406-418 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-154 | 9 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-183 | 24 | |
| α-helix | 186-190 | 5 | |
| α-helix | 221-243 | 23 | |
| α-helix | 250-252 | 3 | |
| α-helix | 254-273 | 20 | |
| α-helix | 291-299 | 9 | |
| α-helix | 300-308 | 9 | |
| α-helix | 312-323 | 12 | |
| α-helix | 325-349 | 25 | |
| α-helix | 361-372 | 12 | |
| α-helix | 385-403 | 19 | |
| α-helix | 406-418 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-154 | 9 | |
| α-helix | 156-158 | 3 | |
| α-helix | 160-182 | 23 | |
| α-helix | 186-189 | 4 | |
| α-helix | 221-242 | 22 | |
| α-helix | 254-273 | 20 | |
| α-helix | 291-299 | 9 | |
| α-helix | 300-309 | 10 | |
| α-helix | 312-323 | 12 | |
| α-helix | 325-349 | 25 | |
| α-helix | 361-372 | 12 | |
| α-helix | 385-403 | 19 | |
| α-helix | 406-418 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | A | protein | 59 | Dendroaspis angusticeps | P00980 (AlphaFold model) |
| Potassium voltage-gated channel subfamily A member 2 | B, C, D, E | protein | 536 | Rattus norvegicus | P63142 (AlphaFold model) |
>8VC3_1 Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin (chains A) GPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
>8VC3_2 Potassium voltage-gated channel subfamily A member 2 (chains B, C, D, E) MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKLVPRGSMTVATGDPVDEAAAHPGHPQDTY DPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRP SFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPEN EFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFH TYSQSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAI IPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKA SMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPT TIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPD LKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV
Cryo-EM structures of Kv1.2 potassium channels, conducting and non-conducting. Wu, Y., Yan, Y., Yang, Y. et al. bioRxiv (2024). DOI 10.1101/2023.06.02.543446 · PubMed
Other PDB entries of the same protein (UniProt P00980 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8VC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.