8VMG: GSK-3 26-383

Crystal structure of GSK-3 26-383 bound to Axin 383-435. Determined by X-ray diffraction at 2.45 Å resolution. Released 28 Aug 2024.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 6,672
Mol. weight: 101.72 kDa
Ligands: ADP, MG
Released: 28 Aug 2024

Explore 8VMG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VMG contains 51 α-helices and 25 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	27-30	4	1
β-strand	36-44	9	1
β-strand	52-65	14	1
β-strand	68-75	8	1
β-strand	81-88	8	1
α-helix	97-103	7
β-strand	109	1	2
β-strand	112-119	8	1
β-strand	126-133	8	1
β-strand	137-138	2	2
α-helix	139-148	10
α-helix	152-154	3
α-helix	155-174	20
β-strand	177-178	2	3
α-helix	184-186	3
β-strand	187-190	4	2
β-strand	195-198	4	2
β-strand	205-206	2	3
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	262-273	12
α-helix	275-277	3
α-helix	278-284	7
α-helix	286-288	3
α-helix	296-300	5
α-helix	301-304	4
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-340	3
α-helix	341-344	4
α-helix	355-356	2
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-383	4

Chain B: 25 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	37-44	8	4
β-strand	52-65	14	4
β-strand	68-75	8	4
β-strand	81-88	8	4
α-helix	96-103	8
β-strand	109	1	5
β-strand	112-119	8	4
β-strand	126-133	8	4
β-strand	137-138	2	5
α-helix	139-148	10
α-helix	152-154	3
α-helix	155-174	20
β-strand	177-178	2	6
α-helix	184-186	3
β-strand	187-189	3	5
β-strand	196-198	3	5
α-helix	201-203	3
β-strand	205-206	2	6
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	262-273	12
α-helix	276-277	2
α-helix	278-284	7
α-helix	286-288	3
α-helix	296-300	5
α-helix	301-304	4
α-helix	311-318	8
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-344	7
α-helix	354-356	3
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-383	4

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	385-414	30

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	385-410	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen synthase kinase-3 beta	A, B	protein	364	Mus musculus	Q9WV60 (AlphaFold model)
Axin-1	C, D	protein	60	Homo sapiens	O15169 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8VMG_1 Glycogen synthase kinase-3 beta (chains A, B)
MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIK
KVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARH
YSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAK
QLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQ
LVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTP
TARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARHH
HHHH

Sequence of entity 2 (C, D), FASTA

>8VMG_2 Axin-1 (chains C, D)
GGWGSGGVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPC

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (EDO, NO3, GOL, SO4, CL, MES) are not listed.

Primary citation

Structural and functional effects of phosphopriming and scaffolding in the kinase GSK-3 beta. Enos, M.D., Gavagan, M., Jameson, N. et al. Sci Signal (2024) 17. DOI 10.1126/scisignal.ado0881 · PubMed

Other PDB entries of the same protein (UniProt Q9WV60 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AE3 2.14 Å, Crystal structure of GSK3beta complexed with Morin
8VME 2.3 Å, Crystal structure of the GSK-3/Axin complex bound to a phosphorylated beta-catenin T41A…
4NU1 2.5 Å, Crystal structure of a transition state mimic of the GSK-3/Axin complex bound to…
8VMF 2.5 Å, Crystal structure of a transition-state mimic of the GSK-3/Axin complex bound to a…
5AIR 2.53 Å, Structural analysis of mouse GSK3beta fused with LRP6 peptide.

Browse structure collections

About this viewer

MolViewer shows 8VMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.