8WVW: LGR4 in state II

Cryo-EM structure of LGR4 in state II. Determined by electron microscopy at 3.53 Å resolution. Released 30 Oct 2024.

Method: Electron microscopy
Resolution: 3.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,594
Mol. weight: 91.87 kDa
Released: 30 Oct 2024

Explore 8WVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WVW contains 20 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	1
β-strand	40-42	3	1
β-strand	61-63	3	1
β-strand	85-87	3	1
β-strand	109-111	3	1
β-strand	119	1	2
β-strand	133-135	3	1
β-strand	143	1	2
β-strand	157-159	3	1
α-helix	170-173	4
β-strand	181-183	3	1
β-strand	191-192	2	3
β-strand	205-207	3	1
β-strand	215-216	2	3
β-strand	229-231	3	1
α-helix	242-246	5
β-strand	252-254	3	1
β-strand	262-263	2	4
β-strand	277-278	2	1
β-strand	286-287	2	4
β-strand	302-304	3	5
α-helix	312-314	3
β-strand	323-327	5	5
β-strand	333	1	6
α-helix	338-341	4
β-strand	347-349	3	5
β-strand	357	1	6
β-strand	369-370	2	5
β-strand	379-380	2	7
β-strand	393-395	3	5
β-strand	403-404	2	7
α-helix	408-410	3
β-strand	417-419	3	5
β-strand	438-440	3	5
α-helix	450-452	3
β-strand	461	1	5
α-helix	470-473	4
α-helix	541-563	23
α-helix	574-600	27
α-helix	606-613	8
α-helix	617-630	14
α-helix	644-646	3
α-helix	659-665	7
α-helix	667-678	12
α-helix	706-729	24
α-helix	741-767	27
α-helix	769-772	4
α-helix	779-788	10
α-helix	793-803	11
α-helix	806-814	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4	A	protein	832	Homo sapiens	Q9BXB1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8WVW_1 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains A)
MKTIIALSYIFCLVFADYKDDDDAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISS

Primary citation

Cryo-EM structure of LGR4 in state I. Lin, C., Chang, Z. To be published.

Other PDB entries of the same protein (UniProt Q9BXB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
4QXF 2.25 Å, crystal structure of human LGR4 and Rspo1
4KT1 2.5 Å, Complex of R-spondin 1 with LGR4 extracellular domain
9KGK 2.63 Å, Structure of the complex of LGR4 with NB18
8XUM 2.9 Å, Structure of LGR4 with RSPO2
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8XT9 3.1 Å, structure of LGR4
8XFS 3.2 Å, LGR4-RSPO2-ZNRF3 RING domain (1:2:2)
8XFP 3.21 Å, the pentamerA complex of LGR4-RSPO2-ZNRF3(delta RING)
8XFT 3.24 Å, LGR4-RSPO2-ZNRF3(1:1:1)
9KB8 3.25 Å, Cryo-EM structure of LGR4-RSPO2-ZNRF3 complex (1:1:2)
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin

Browse structure collections

About this viewer

MolViewer shows 8WVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.