8X0L: Semliki Forest virus
Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(3-fold). Determined by electron microscopy at 3.5 Å resolution. Released 27 Nov 2024.
- Method
- Electron microscopy
- Resolution
- 3.5 Å
- Organisms
- Semliki Forest virus, Homo sapiens
- Chains
- 12
- Atoms
- 24,555
- Mol. weight
- 350.95 kDa
- Ligands
- CA, NAG
- Released
- 27 Nov 2024
Explore 8X0L in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8X0L contains 73 α-helices and 271 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 107-119 | 13 | |
| β-strand | 120-125 | 6 | 1 |
| β-strand | 128-136 | 9 | 1 |
| β-strand | 139-143 | 5 | 1 |
| β-strand | 149-150 | 2 | 1 |
| β-strand | 161-163 | 3 | 1 |
| β-strand | 168-172 | 5 | 1 |
| α-helix | 173-174 | 2 | |
| α-helix | 175-177 | 3 | |
| β-strand | 191-194 | 4 | 2 |
| β-strand | 200-202 | 3 | 2 |
| β-strand | 207-210 | 4 | 2 |
| β-strand | 222-224 | 3 | 2 |
| β-strand | 230-240 | 11 | 2 |
| β-strand | 243-249 | 7 | 2 |
| β-strand | 258-259 | 2 | 2 |
| β-strand | 265-266 | 2 | 2 |
Chain B: 10 helices, 34 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 337-343 | 7 | |
| β-strand | 345 | 1 | 3 |
| β-strand | 350-352 | 3 | 4 |
| β-strand | 361-363 | 3 | 4 |
| β-strand | 367-371 | 5 | 5 |
| β-strand | 379-389 | 11 | 5 |
| β-strand | 395-404 | 10 | 5 |
| β-strand | 407-412 | 6 | 5 |
| α-helix | 413-415 | 3 | |
| β-strand | 417-419 | 3 | 6 |
| β-strand | 425-437 | 13 | 5 |
| β-strand | 441-449 | 9 | 6 |
| β-strand | 455-464 | 10 | 6 |
| β-strand | 472 | 1 | 7 |
| β-strand | 481-489 | 9 | 8 |
| β-strand | 499-503 | 5 | 9 |
| α-helix | 504-507 | 4 | |
| β-strand | 509 | 1 | 10 |
| β-strand | 514-517 | 4 | 11 |
| β-strand | 520-523 | 4 | 11 |
| β-strand | 530-534 | 5 | 10 |
| β-strand | 541-544 | 4 | 10 |
| β-strand | 549-551 | 3 | 11 |
| α-helix | 555-557 | 3 | |
| β-strand | 558-562 | 5 | 10 |
| β-strand | 568 | 1 | 3 |
| β-strand | 569-570 | 2 | 9 |
| β-strand | 577 | 1 | 12 |
| β-strand | 585-588 | 4 | 9 |
| β-strand | 593-601 | 9 | 8 |
| α-helix | 602-606 | 5 | |
| β-strand | 607-609 | 3 | 13 |
| β-strand | 614-619 | 6 | 13 |
| β-strand | 625-631 | 7 | 7 |
| β-strand | 639-643 | 5 | 7 |
| β-strand | 647-652 | 6 | 13 |
| β-strand | 658-662 | 5 | 7 |
| α-helix | 666-667 | 2 | |
| β-strand | 668-670 | 3 | 7 |
| β-strand | 671-672 | 2 | 14 |
| α-helix | 684-694 | 11 | |
| α-helix | 696-729 | 34 | |
| α-helix | 730-733 | 4 | |
| α-helix | 742-747 | 6 | |
Chain C: 10 helices, 39 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 817-823 | 7 | 15 |
| β-strand | 830-834 | 5 | 16 |
| β-strand | 839 | 1 | 17 |
| β-strand | 842-863 | 22 | 16 |
| β-strand | 866-869 | 4 | 18 |
| α-helix | 871-873 | 3 | |
| β-strand | 874-876 | 3 | 12 |
| β-strand | 892-897 | 6 | 12 |
| β-strand | 902 | 1 | 19 |
| β-strand | 907 | 1 | 19 |
| β-strand | 916-921 | 6 | 12 |
| β-strand | 922-925 | 4 | 18 |
| β-strand | 934-952 | 19 | 16 |
| β-strand | 955-962 | 8 | 16 |
| β-strand | 968-970 | 3 | 15 |
| β-strand | 975-978 | 4 | 15 |
| β-strand | 991-995 | 5 | 16 |
| β-strand | 998-1000 | 3 | 16 |
| α-helix | 1005-1006 | 2 | |
| β-strand | 1018-1019 | 2 | 20 |
| β-strand | 1020 | 1 | 16 |
| β-strand | 1029-1030 | 2 | 20 |
| β-strand | 1035-1036 | 2 | 21 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1048-1049 | 2 | 21 |
| α-helix | 1051-1053 | 3 | |
| α-helix | 1054-1060 | 7 | |
| α-helix | 1066-1068 | 3 | |
| α-helix | 1071-1073 | 3 | |
| β-strand | 1075-1077 | 3 | 16 |
| β-strand | 1082-1084 | 3 | 16 |
| β-strand | 1090-1096 | 7 | 15 |
| α-helix | 1099-1101 | 3 | |
| β-strand | 1104 | 1 | 17 |
| β-strand | 1112-1121 | 10 | 22 |
| β-strand | 1122 | 1 | 23 |
| β-strand | 1129-1136 | 8 | 22 |
| β-strand | 1141-1144 | 4 | 24 |
| β-strand | 1145-1147 | 3 | 25 |
| β-strand | 1153-1154 | 2 | 26 |
| β-strand | 1158-1161 | 4 | 24 |
| β-strand | 1166-1170 | 5 | 22 |
| β-strand | 1171-1172 | 2 | 26 |
| β-strand | 1179-1184 | 6 | 25 |
| β-strand | 1187-1192 | 6 | 25 |
| β-strand | 1196 | 1 | 23 |
| β-strand | 1202-1203 | 2 | 14 |
| α-helix | 1214-1216 | 3 | |
| α-helix | 1220-1252 | 33 | |
Chains D, H and L: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 87-89 | 3 | 81 |
| β-strand | 97-99 | 3 | 81 |
| α-helix | 100-102 | 3 | |
Chain E: 4 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 107-116 | 10 | |
| β-strand | 121-125 | 5 | 27 |
| β-strand | 128-133 | 6 | 27 |
| β-strand | 134-136 | 3 | 28 |
| β-strand | 139-143 | 5 | 28 |
| β-strand | 149-150 | 2 | 27 |
| α-helix | 153-157 | 5 | |
| β-strand | 161-163 | 3 | 28 |
| β-strand | 168-172 | 5 | 28 |
| β-strand | 184 | 1 | 29 |
| β-strand | 191-195 | 5 | 29 |
| β-strand | 198-203 | 6 | 29 |
| β-strand | 206-210 | 5 | 29 |
| α-helix | 211-213 | 3 | |
| α-helix | 221 | 1 | |
| β-strand | 222-224 | 3 | 29 |
| β-strand | 230-240 | 11 | 29 |
| β-strand | 243-250 | 8 | 29 |
| β-strand | 257-259 | 3 | 29 |
| β-strand | 265-266 | 2 | 29 |
Chain F: 9 helices, 36 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 337-343 | 7 | |
| β-strand | 345 | 1 | 30 |
| β-strand | 350-352 | 3 | 31 |
| β-strand | 354 | 1 | 32 |
| β-strand | 361-363 | 3 | 31 |
| β-strand | 367-371 | 5 | 33 |
| β-strand | 379-390 | 12 | 33 |
| β-strand | 394-404 | 11 | 33 |
| β-strand | 407-412 | 6 | 33 |
| α-helix | 413-415 | 3 | |
| β-strand | 417-419 | 3 | 32 |
| β-strand | 423 | 1 | 32 |
| β-strand | 425-437 | 13 | 33 |
| β-strand | 441-449 | 9 | 32 |
| β-strand | 455-464 | 10 | 32 |
| β-strand | 472 | 1 | 34 |
| β-strand | 481-489 | 9 | 35 |
| β-strand | 499-503 | 5 | 36 |
| α-helix | 504-507 | 4 | |
| β-strand | 508-509 | 2 | 37 |
| β-strand | 514-517 | 4 | 38 |
| β-strand | 520-523 | 4 | 38 |
| β-strand | 530-533 | 4 | 37 |
| β-strand | 541-544 | 4 | 37 |
| β-strand | 549-551 | 3 | 38 |
| α-helix | 555-557 | 3 | |
| β-strand | 561-562 | 2 | 37 |
| β-strand | 568 | 1 | 30 |
| β-strand | 569-570 | 2 | 36 |
| β-strand | 577 | 1 | 39 |
| β-strand | 585-588 | 4 | 36 |
| β-strand | 593-601 | 9 | 35 |
| α-helix | 603-606 | 4 | |
| β-strand | 607-609 | 3 | 40 |
| β-strand | 614-619 | 6 | 40 |
| β-strand | 625-631 | 7 | 34 |
| β-strand | 639-643 | 5 | 34 |
| β-strand | 647-652 | 6 | 40 |
| β-strand | 658-662 | 5 | 34 |
| β-strand | 668-670 | 3 | 34 |
| β-strand | 671-672 | 2 | 41 |
| α-helix | 684-694 | 11 | |
| α-helix | 696-728 | 33 | |
| α-helix | 731-733 | 3 | |
| α-helix | 744-747 | 4 | |
Chain G: 11 helices, 39 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 817-823 | 7 | 42 |
| β-strand | 830-834 | 5 | 43 |
| β-strand | 839 | 1 | 44 |
| β-strand | 842-857 | 16 | 43 |
| β-strand | 861-863 | 3 | 45 |
| β-strand | 866-869 | 4 | 46 |
| α-helix | 871-873 | 3 | |
| β-strand | 874-876 | 3 | 39 |
| β-strand | 892-897 | 6 | 39 |
| β-strand | 902 | 1 | 47 |
| β-strand | 907 | 1 | 47 |
| β-strand | 916-921 | 6 | 39 |
| β-strand | 922-925 | 4 | 46 |
| β-strand | 934-938 | 5 | 45 |
| β-strand | 939-952 | 14 | 43 |
| β-strand | 955-962 | 8 | 43 |
| β-strand | 969-970 | 2 | 42 |
| β-strand | 975-978 | 4 | 42 |
| β-strand | 991-995 | 5 | 45 |
| β-strand | 998-1000 | 3 | 45 |
| α-helix | 1005-1006 | 2 | |
| β-strand | 1018-1019 | 2 | 48 |
| β-strand | 1020 | 1 | 45 |
| β-strand | 1029-1030 | 2 | 48 |
| β-strand | 1035-1036 | 2 | 49 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1048-1049 | 2 | 49 |
| α-helix | 1051-1053 | 3 | |
| α-helix | 1054-1060 | 7 | |
| α-helix | 1066-1068 | 3 | |
| α-helix | 1071-1073 | 3 | |
| β-strand | 1075-1077 | 3 | 43 |
| β-strand | 1082-1084 | 3 | 43 |
| β-strand | 1090-1096 | 7 | 42 |
| α-helix | 1099-1101 | 3 | |
| β-strand | 1104 | 1 | 44 |
| β-strand | 1112-1121 | 10 | 50 |
| β-strand | 1129-1136 | 8 | 50 |
| β-strand | 1141-1144 | 4 | 51 |
| β-strand | 1147 | 1 | 52 |
| β-strand | 1152-1154 | 3 | 53 |
| β-strand | 1158-1161 | 4 | 51 |
| β-strand | 1166-1170 | 5 | 50 |
| β-strand | 1171-1173 | 3 | 53 |
| β-strand | 1179-1184 | 6 | 52 |
| β-strand | 1187-1192 | 6 | 52 |
| β-strand | 1202-1203 | 2 | 41 |
| α-helix | 1206-1207 | 2 | |
| α-helix | 1214-1216 | 3 | |
| α-helix | 1220-1252 | 33 | |
Chain I: 3 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 107-119 | 13 | |
| β-strand | 121-122 | 2 | 54 |
| β-strand | 123-124 | 2 | 55 |
| β-strand | 125 | 1 | 56 |
| β-strand | 128 | 1 | 56 |
| β-strand | 132-133 | 2 | 54 |
| β-strand | 134-136 | 3 | 57 |
| β-strand | 139-142 | 4 | 57 |
| β-strand | 149-150 | 2 | 55 |
| α-helix | 153-156 | 4 | |
| β-strand | 161-163 | 3 | 57 |
| β-strand | 168-170 | 3 | 57 |
| α-helix | 175-177 | 3 | |
| β-strand | 191-194 | 4 | 58 |
| β-strand | 200-203 | 4 | 58 |
| β-strand | 206-210 | 5 | 58 |
| β-strand | 222-224 | 3 | 58 |
| β-strand | 230-240 | 11 | 58 |
| β-strand | 243-250 | 8 | 58 |
| β-strand | 257-258 | 2 | 58 |
| β-strand | 265-266 | 2 | 58 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Capsid protein | A, E, I | protein | 162 | Semliki Forest virus | P03315 (AlphaFold model) |
| pike glycoprotein E2 | B, F, J | protein | 418 | Semliki Forest virus | P03315 (AlphaFold model) |
| pike glycoprotein E1 | C, G, K | protein | 438 | Semliki Forest virus | P03315 (AlphaFold model) |
| Very low-density lipoprotein receptor | D, H, L | protein | 37 | Homo sapiens | P98155 (AlphaFold model) |
Sequence of entity 1 (A, E, I), FASTA
>8X0L_1 Capsid protein (chains A, E, I)
GKRERMCMKIENDCIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSK
YDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFD
NKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW
Sequence of entity 2 (B, F, J), FASTA
>8X0L_2 pike glycoprotein E2 (chains B, F, J)
SVSQHFNVYKATRPYIAYCADCGAGHSCHSPVAIEAVRSEATDGMLKIQFSAQIGIDKSD
NHDYTKIRYADGHAIENAVRSSLKVATSGDCFVHGTMGHFILAKCPPGEFLQVSIQDTRN
AVRACRIQYHHDPQPVGREKFTIRPHYGKEIPCTTYQQTTAKTVEEIDMHMPPDTPDRTL
LSQQSGNVKITVGGKKVKYNCTCGTGNVGTTNSDMTINTCLIEQCHVSVTDHKKWQFNSP
FVPRADEPARKGKVHIPFPLDNITCRVPMAREPTVIHGKREVTLHLHPDHPTLFSYRTLG
EDPQYHEEWVTAAVERTIPVPVDGMEYHWGNNDPVRLWSQLTTEGKPHGWPHQIVQYYYG
LYPAATVSAVVGMSLLALISIFASCYMLVAARSKCLTPYALTPGAAVPWTLGILCCAP
Sequence of entity 3 (C, G, K), FASTA
>8X0L_3 pike glycoprotein E1 (chains C, G, K)
YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV
KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS
AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY
KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF
KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT
CTVATCTHSSDFGGVLTLTYKTDKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS
ASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAF
AIGAILVLVVVTCIGLRR
Sequence of entity 4 (D, H, L), FASTA
>8X0L_4 Very low-density lipoprotein receptor (chains D, H, L)
CRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENC
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 3 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(2-fold). Gao, F.G., Liu, S. To be published.
Other PDB entries of the same protein (UniProt P03315 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2V33 1.55 Å, High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki…
- 1I9W 3.0 Å, Crystal structure of the fusion glycoprotein E1 from semliki forest virus
- 1VCP 3.0 Å, Semliki forest virus capsid protein (crystal form I)
- 2ALA 3.0 Å, Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric…
- 8IHP 3.0 Å, Structure of Semliki Forest virus VLP in complex with the receptor VLDLR-LA3
- 8YVY 3.02 Å, Semliki Forest virus virion
- 1VCQ 3.1 Å, Semliki forest virus capsid protein (crystal form II)
- 1RER 3.2 Å, Crystal structure of the homotrimer of fusion glycoprotein E1 from Semliki Forest Virus.
- 8YW1 3.44 Å, Semliki Forest virus viron in complex with VLDLR
- 8YVZ 3.45 Å, Semliki Forest virus viron
- 8X0K 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(2-fold)
- 8X0M 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(5-fold)
Browse structure collections
About this viewer
MolViewer shows 8X0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.