9HGC: Human GABARAPL1
Crystal structure of human GABARAPL1 in complex with cyclic peptide GAB_D8. Determined by X-ray diffraction at 2.52 Å resolution. Released 9 Jul 2025.
- Method
- X-ray diffraction
- Resolution
- 2.52 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 8
- Atoms
- 4,542
- Mol. weight
- 64.13 kDa
- Released
- 9 Jul 2025
Explore 9HGC in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9HGC contains 23 α-helices and 30 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
Chain C: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 3 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 3 |
| β-strand | 56 | 1 | 4 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 3 |
| β-strand | 90 | 1 | 4 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 3 |
Chains D and F: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 3 |
| β-strand | 9-12 | 4 | 3 |
Chain E: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-3 | 2 | |
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 5 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 5 |
| β-strand | 56 | 1 | 6 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 5 |
| β-strand | 90 | 1 | 6 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 5 |
Chain G: 6 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 7 |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 7 |
| β-strand | 56 | 1 | 8 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 8 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 7 |
Chain H: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 7 |
| β-strand | 9-12 | 4 | 7 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor-associated protein-like 1 | A, C, E, G | protein | 119 | Homo sapiens | Q9H0R8 (AlphaFold model) |
| GAB_D8 | B, D, F, H | protein | 15 | synthetic construct | |
Sequence of entity 1 (A, C, E, G), FASTA
>9HGC_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A, C, E, G)
GSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVG
QFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Sequence of entity 2 (B, D, F, H), FASTA
>9HGC_2 GAB_D8 (chains B, D, F, H)
GSEYEEDGWTVLEPD
Primary citation
Accurate de novo design of high-affinity protein-binding macrocycles using deep learning. Rettie, S.A., Juergens, D., Adebomi, V. et al. Nat Chem Biol (2025) 21:1948-1956. DOI 10.1038/s41589-025-01929-w · PubMed
Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6YOO 1.06 Å, Structure of SAMM50 LIR bound to GABARAPL1
- 6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
- 6HOL 1.4 Å, Structure of ATG14 LIR motif bound to GABARAPL1
- 5LXI 1.44 Å, GABARAP-L1 ATG4B LIR Complex
- 7AA7 1.45 Å, Structure of SCOC pS12/pS18 LIR motif bound to GABARAPL1
- 8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1
- 5LXH 1.58 Å, GABARAP-L1 ATG4B LIR Complex
- 2R2Q 1.65 Å, Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1…
- 7AA9 1.72 Å, Structure of SCOC pT13/pT15 LIR motif bound to GABARAPL1
- 9JF2 1.76 Å, Crystal structure of GABARAPL1 in complex with ATG16L1
- 7JHX 1.91 Å, Crystal structure of hEPG5 LIR/GABARAPL1 complex
- 5DPT 2.9 Å, Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117
Browse structure collections
About this viewer
MolViewer shows 9HGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.