Structure of enterovirus protease in complex host factor. Determined by electron microscopy at 3.14 Å resolution. Released 29 May 2024.
Explore 8X8Q in 3D Show helices and sheets RCSB PDB PDBe
8X8Q contains 28 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 24-36 | 13 | |
| α-helix | 46-63 | 18 | |
| α-helix | 75-77 | 3 | |
| α-helix | 79-88 | 10 | |
| β-strand | 96-101 | 6 | 1 |
| β-strand | 105-110 | 6 | 1 |
| β-strand | 114 | 1 | 2 |
| β-strand | 119-124 | 6 | 3 |
| α-helix | 125-127 | 3 | |
| β-strand | 129-130 | 2 | 4 |
| α-helix | 131-135 | 5 | |
| α-helix | 140-145 | 6 | |
| α-helix | 147-151 | 5 | |
| α-helix | 153-165 | 13 | |
| α-helix | 173-178 | 6 | |
| α-helix | 186-188 | 3 | |
| α-helix | 191-195 | 5 | |
| α-helix | 202-226 | 25 | |
| α-helix | 228-230 | 3 | |
| α-helix | 241-253 | 13 | |
| β-strand | 255-259 | 5 | 4 |
| β-strand | 266-270 | 5 | 4 |
| β-strand | 278-279 | 2 | 5 |
| β-strand | 286-289 | 4 | 3 |
| β-strand | 294-298 | 5 | 3 |
| β-strand | 303 | 1 | 2 |
| β-strand | 308 | 1 | 1 |
| β-strand | 310-311 | 2 | 5 |
| α-helix | 318-320 | 3 | |
| α-helix | 321-325 | 5 | |
| β-strand | 336-342 | 7 | 6 |
| α-helix | 350-360 | 11 | |
| β-strand | 365-371 | 7 | 6 |
| α-helix | 379-389 | 11 | |
| α-helix | 404-409 | 6 | |
| α-helix | 410-412 | 3 | |
| α-helix | 420-440 | 21 | |
| α-helix | 445-454 | 10 | |
| α-helix | 459-494 | 36 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-12 | 3 | 7 |
| β-strand | 15-19 | 5 | 7 |
| α-helix | 25-29 | 5 | |
| β-strand | 31-35 | 5 | 7 |
| β-strand | 40-44 | 5 | 7 |
| α-helix | 48-49 | 2 | |
| β-strand | 53 | 1 | 3 |
| β-strand | 60-65 | 6 | 3 |
| β-strand | 70-75 | 6 | 3 |
| α-helix | 77-78 | 2 | |
| β-strand | 80 | 1 | 3 |
| β-strand | 98-102 | 5 | 3 |
| α-helix | 112 | 1 | |
| β-strand | 113-115 | 3 | 3 |
| β-strand | 120-128 | 9 | 3 |
| β-strand | 131-136 | 6 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin-histidine N-methyltransferase | B | protein | 594 | Homo sapiens | Q86TU7 (AlphaFold model) |
| 2A protein (Fragment) | F | protein | 150 | Enterovirus A71 | R9YK28 |
>8X8Q_1 Actin-histidine N-methyltransferase (chains B) MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKI RKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELF LWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLP SEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFT YEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVAL QDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARA GIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSW DNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVK SAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIRE AISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE
>8X8Q_2 2A protein (Fragment) (chains F) GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQT GVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGV VGIVSTGGNGLVGFADVRDLLWLDEEAMEQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
The EV71 2A protease occupies the central cleft of SETD3 and disrupts SETD3-actin interaction. Gao, X., Wang, B., Zhu, K. et al. Nat Commun (2024) 15:4176-4176. DOI 10.1038/s41467-024-48504-w · PubMed
Other PDB entries of the same protein (UniProt Q86TU7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8X8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.