Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment. Determined by X-ray diffraction at 2.04 Å resolution. Released 5 Jun 2024.
Explore 8X8S in 3D Show helices and sheets RCSB PDB PDBe
8X8S contains 9 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-28 | 16 | |
| β-strand | 34-43 | 10 | 1 |
| β-strand | 48-56 | 9 | 1 |
| β-strand | 58-65 | 8 | 2 |
| β-strand | 106-113 | 8 | 1 |
| β-strand | 117 | 1 | 3 |
| α-helix | 119-121 | 3 | |
| β-strand | 123-125 | 3 | 2 |
| α-helix | 137-139 | 3 | |
| β-strand | 144 | 1 | 2 |
| α-helix | 147-149 | 3 | |
| α-helix | 150 | 1 | |
| β-strand | 151-155 | 5 | 1 |
| β-strand | 158-167 | 10 | 1 |
| β-strand | 175-182 | 8 | 2 |
| β-strand | 183 | 1 | 3 |
| α-helix | 197-206 | 10 | |
| β-strand | 208-214 | 7 | 1 |
| α-helix | 217-220 | 4 | |
| α-helix | 221-225 | 5 | |
| α-helix | 226-228 | 3 | |
| β-strand | 232-233 | 2 | 4 |
| β-strand | 239-240 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyhedrin,Myc proto-oncogene protein | A | protein | 248 | Bombyx mori cypovirus 1, Homo sapiens | P01106 (AlphaFold model), P11041 |
>8X8S_1 Polyhedrin,Myc proto-oncogene protein (chains A) MADVAGTSNRDFRGYILSVQAEEQKNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVG ISETFKALKEYREGQHNDSYDEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVR TIKMAKGNAVSVPDEYLQRSHPWEATGIKYKKIKRDGEIVGYSHYFELPHEYNSISLAVS GVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY GVALSNRQ
High-throughput structure determination of an intrinsically disordered protein using cell-free protein crystallization. Kojima, M., Abe, S., Furuta, T. et al. Proc Natl Acad Sci U S A (2024) 121:e2322452121-e2322452121. DOI 10.1073/pnas.2322452121 · PubMed
Other PDB entries of the same protein (UniProt P01106 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8X8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.