8XI9: FRB-FKBP fusion protein

Crystal structure of FRB-FKBP fusion protein in complex with rapamycin. Determined by X-ray diffraction at 1.85 Å resolution. Released 7 Aug 2024.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,809
Mol. weight: 24.24 kDa
Ligands: RAP
Released: 7 Aug 2024

Explore 8XI9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XI9 contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-15	13
α-helix	16-20	5
α-helix	24-38	15
α-helix	45-71	27
α-helix	74-92	19
β-strand	97-103	7	1
α-helix	115	1
β-strand	116-125	10	1
β-strand	130-133	4	1
β-strand	141-144	4	1
α-helix	152-158	7
α-helix	161-162	2
β-strand	166-171	6	1
α-helix	173-175	3
β-strand	182	1	2
β-strand	186	1	2
β-strand	192-201	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FRB-FKBP fusion protein	A	protein	202	Homo sapiens	P42345 (AlphaFold model), P62942 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8XI9_1 FRB-FKBP fusion protein (chains A)
MGWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLME
AQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQMGVQVETISPGDGRTFPKRGQTCVVH
YTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGAT
GHPGIIPPHATLVFDVELLKLE

Ligands and cofactors

ID	Name	Formula	Copies
RAP	Rapamycin immunosuppressant drug	C51 H79 N O13	1

Primary citation

Structural insights into rapamycin-induced oligomerization of a FRB-FKBP fusion protein. Inobe, T., Sakaguchi, R., Obita, T. et al. FEBS Lett (2024) 598:2292-2305. DOI 10.1002/1873-3468.14986 · PubMed

Other PDB entries of the same protein (UniProt P42345 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DRI 1.45 Å, Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of…
9DBO 1.55 Å, Crystal structure of a synthetic Fab (R3E9) in complex with the FRB domain of mTOR
5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
5WBH 1.75 Å, Structure of the FRB domain of mTOR bound to a substrate recruitment peptide of S6K1
4DRJ 1.8 Å, o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
3FAP 1.85 Å, Atomic structures of the rapamycin analogs in complex with both human FKBP12 and frb…
8PPZ 1.85 Å, Co-crystal structure of FKBP12, compound 7 and the FRB fragment of mTOR
9PIW 1.9 Å, Crystal structure of a synthetic Fab (1A) in complex with the FRB domain of mTOR
9DL0 2.0 Å, Crystal structure of a synthetic Fab (R3H8) in complex with the FRB domain of mTOR
9PJ1 2.05 Å, Crystal structure of a synthetic Fab (4R) in complex with the ternary assembly of…
9PIU 2.18 Å, Crystal structure of a synthetic Fab (2C) in complex with the FRB domain of mTOR
1NSG 2.2 Å, The structure of the immunophilin-immunosuppressant FKBP12-rapamycin complex interacting…

Browse structure collections

About this viewer

MolViewer shows 8XI9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.