8XT9: LGR4

structure of LGR4. Determined by electron microscopy at 3.1 Å resolution. Released 15 Jan 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Homo sapiens, Camelus bactrianus
Chains: 2
Atoms: 6,479
Mol. weight: 116.57 kDa
Released: 15 Jan 2025

Explore 8XT9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XT9 contains 22 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	425-429	5	9
β-strand	440-445	6	10
β-strand	452-457	6	10
α-helix	459-461	3
β-strand	463-465	3	10
α-helix	467-469	3
β-strand	473-477	5	9
β-strand	483-488	6	9
α-helix	493-495	3
β-strand	497-503	7	10
α-helix	515-517	3
β-strand	520-521	2	10
β-strand	525-527	3	10

Chain C: 18 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	35-36	2	1
β-strand	40-44	5	1
β-strand	61-65	5	1
β-strand	71-72	2	2
β-strand	85-87	3	1
β-strand	95-96	2	2
β-strand	109-111	3	1
β-strand	119	1	3
α-helix	122-126	5
β-strand	133-135	3	1
β-strand	143	1	3
β-strand	157-159	3	1
α-helix	170-175	6
β-strand	181-183	3	1
β-strand	191-192	2	4
β-strand	205-207	3	1
β-strand	215-216	2	4
β-strand	229-231	3	1
α-helix	244-246	3
β-strand	252-254	3	1
β-strand	262-263	2	5
β-strand	276-278	3	1
β-strand	286-287	2	5
α-helix	289-291	3
β-strand	300-304	5	6
β-strand	323-327	5	6
α-helix	338-341	4
β-strand	347-349	3	6
β-strand	369-371	3	6
β-strand	380	1	7
β-strand	393-395	3	6
β-strand	404	1	7
β-strand	417-419	3	6
β-strand	438-440	3	6
β-strand	461-463	3	6
α-helix	467-470	4
β-strand	521-522	2	6
β-strand	534	1	8
α-helix	539-565	27
α-helix	572-600	29
β-strand	602	1	8
α-helix	605-613	9
α-helix	616-648	33
α-helix	658-678	21
α-helix	679-681	3
α-helix	704-731	28
α-helix	746-768	23
α-helix	769-771	3
α-helix	779-789	11
α-helix	792-803	12
α-helix	806-820	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4	C	protein	951	Homo sapiens	Q9BXB1 (AlphaFold model)
MB52	A	protein	110	Camelus bactrianus	A0A0F6YEF6 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8XT9_1 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains C)
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD

Sequence of entity 2 (A), FASTA

>8XT9_2 MB52 (chains A)
GSLRLSCAASGYTYSPYCMGWFRQAPGKAREGVATVDLDGSTIYADSVKGRFTISQDNAK
NTLYLQMNSLKPEDTAMYYCASRTRAGVTCGLNWAIFSYWGQGTQVTVSS

Primary citation

Cryo-EM structure of the full-length LGR4-RSPOs complex and a targeting nanobody for anti-obesity therapy. Zhang, Z., Wang, L., Qiao, H. et al. Nat Commun (2025) 16:8406-8406. DOI 10.1038/s41467-025-63410-5 · PubMed

Other PDB entries of the same protein (UniProt Q9BXB1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
4QXF 2.25 Å, crystal structure of human LGR4 and Rspo1
4KT1 2.5 Å, Complex of R-spondin 1 with LGR4 extracellular domain
9KGK 2.63 Å, Structure of the complex of LGR4 with NB18
8XUM 2.9 Å, Structure of LGR4 with RSPO2
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8XFS 3.2 Å, LGR4-RSPO2-ZNRF3 RING domain (1:2:2)
8XFP 3.21 Å, the pentamerA complex of LGR4-RSPO2-ZNRF3(delta RING)
8XFT 3.24 Å, LGR4-RSPO2-ZNRF3(1:1:1)
9KB8 3.25 Å, Cryo-EM structure of LGR4-RSPO2-ZNRF3 complex (1:1:2)
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin
8WVX 3.32 Å, Cryo-EM structure of LGR4 in complex with Norrin(dimer)

Browse structure collections

About this viewer

MolViewer shows 8XT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.