8XWC: Human 8-oxoguanine glycosylase K249H mutant

Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate 8-oxoguanine DNA at pH 8.0 under 277 K. Determined by X-ray diffraction at 1.45 Å resolution. Released 23 Jul 2025.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,683
Mol. weight: 47.64 kDa
Ligands: MG
Released: 23 Jul 2025

Explore 8XWC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWC contains 21 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-14	4
α-helix	20-22	3
β-strand	24-27	4	1
α-helix	35-38	4
β-strand	48-51	4	1
β-strand	54-59	6	1
β-strand	62-68	7	1
β-strand	72-78	7	1
α-helix	83-85	3
α-helix	87-89	3
α-helix	90-99	10
α-helix	106-116	11
α-helix	118-126	9
α-helix	137-147	11
α-helix	152-166	15
α-helix	168	1
β-strand	169-173	5	2
β-strand	176-179	4	2
α-helix	180-183	4
α-helix	184-188	5
α-helix	190-198	9
α-helix	204-218	15
α-helix	223-230	8
α-helix	233-240	8
α-helix	248-258	11
α-helix	269-279	11
α-helix	293-307	15
α-helix	311-323	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-D(APGPCPGPTPCPCPAP(8OG)PGPTPCPTPAPCPC)-3')	C	DNA	16	Homo sapiens
DNA (5'-d(pgpgptpapgpapcpcptpgpgpapcpgp*c)-3')	D	DNA	15	Homo sapiens
N-glycosylase/DNA lyase	A	protein	336	Homo sapiens	O15527 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8XWC_1 DNA (5'-D(*AP*GP*CP*GP*TP*CP*CP*AP*(8OG)P*GP*TP*CP*TP*AP*CP*C)-3') (chains C)
AGCGTCCAGGTCTACC

Sequence of entity 2 (D), FASTA

>8XWC_2 DNA (5'-D(P*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3') (chains D)
GGTAGACCTGGACGC

Sequence of entity 3 (A), FASTA

>8XWC_3 N-glycosylase/DNA lyase (chains A)
GPGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQT
EEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQG
VRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHGFPSLQALAG
PEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKALCILPGVGTH
VADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGP
YAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (NA, GOL, PEG) are not listed.

Primary citation

Capturing a glycosylase reaction intermediate in DNA repair by freeze-trapping of a pH-responsive hOGG1 mutant. Unno, M., Morikawa, M., Sychrovsky, V. et al. Nucleic Acids Res (2025) 53. DOI 10.1093/nar/gkaf718 · PubMed

Other PDB entries of the same protein (UniProt O15527 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XHI 1.55 Å, Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA…
5AN4 1.6 Å, Crystal structure of the human 8-oxoguanine glycosylase (OGG1) processed with the…
8XWU 1.68 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXK 1.7 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXG 1.82 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
9NZ8 1.85 Å, Crystal structure of human OGG1 in a DNA-free state
1M3Q 1.9 Å, Crystal Structure of hogg1 D268E Mutant with Base-Excised DNA and 8-aminoguanine
6RLW 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with inhibitor TH5487
7AYY 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with activator…
9NZ9 2.0 Å, Crystal structure of product-bound human OGG1(WT)
1LWY 2.01 Å, hOgg1 Borohydride-Trapped Intermediate without 8-oxoguanine
2NOH 2.01 Å, Structure of catalytically inactive Q315A human 8-oxoguanine glycosylase complexed to…

Browse structure collections

About this viewer

MolViewer shows 8XWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.