8XWS: CXCR2

Structure of CXCR2 bound to CXCL5 (Ligand-receptor focused map). Determined by electron microscopy at 3.06 Å resolution. Released 15 Jan 2025.

Method: Electron microscopy
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,656
Mol. weight: 110.13 kDa
Released: 15 Jan 2025

Explore 8XWS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWS contains 40 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains B and D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	1
α-helix	24-26	3
β-strand	27-33	7	1
α-helix	34	1
β-strand	43-48	6	1
β-strand	53-56	4	1
α-helix	61-70	10

Chains C and R: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
α-helix	45-75	31
α-helix	82-110	29
α-helix	116-148	33
α-helix	155-159	5
α-helix	162-176	15
α-helix	178-183	6
β-strand	184-187	4	3
β-strand	195-198	4	3
α-helix	204-211	8
α-helix	213-216	4
α-helix	217-221	5
α-helix	222-239	18
α-helix	246-278	33
α-helix	283-284	2
α-helix	286-303	18
α-helix	306-310	5
α-helix	311-315	5
α-helix	319-328	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C motif chemokine 5	B, D	protein	78	Homo sapiens	P42830 (AlphaFold model)
C-X-C chemokine receptor type 2	C, R	protein	416	Homo sapiens	P25025 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>8XWS_1 C-X-C motif chemokine 5 (chains B, D)
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA
PFLKKVIQKILDGGNKEN

Sequence of entity 2 (C, R), FASTA

>8XWS_2 C-X-C chemokine receptor type 2 (chains C, R)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSEDF
NMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLL
GNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSL
LKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFR
RTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGI
LHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Primary citation

Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2. Saha, S., Sano, F.K., Sharma, S. et al. Mol Cell (2025) 85:976-988.e9. DOI 10.1016/j.molcel.2025.01.024 · PubMed

Other PDB entries of the same protein (UniProt P42830 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XX7 3.32 Å, Structure of CXCR2 bound to CXCL5 (CXCR2-CXCL5-Go Full map)
2MGS Solution structure of CXCL5

Browse structure collections

About this viewer

MolViewer shows 8XWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.