Structure of y+LAT1 bound with Leu. Determined by electron microscopy at 3.04 Å resolution. Released 22 Jan 2025.
Explore 8XXI in 3D Show helices and sheets RCSB PDB PDBe
8XXI contains 24 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 39-51 | 13 | |
| α-helix | 61-65 | 5 | |
| α-helix | 69-97 | 29 | |
| α-helix | 104-110 | 7 | |
| α-helix | 117-122 | 6 | |
| α-helix | 123-127 | 5 | |
| α-helix | 128-143 | 16 | |
| α-helix | 152-154 | 3 | |
| α-helix | 155-175 | 21 | |
| α-helix | 177-208 | 32 | |
| α-helix | 225-238 | 14 | |
| α-helix | 244-246 | 3 | |
| α-helix | 255-284 | 30 | |
| α-helix | 288-291 | 4 | |
| α-helix | 296-304 | 9 | |
| α-helix | 311-340 | 30 | |
| β-strand | 351 | 1 | 1 |
| β-strand | 352 | 1 | 2 |
| β-strand | 358 | 1 | 1 |
| α-helix | 359-371 | 13 | |
| α-helix | 372-374 | 3 | |
| α-helix | 380-405 | 26 | |
| α-helix | 419-438 | 20 | |
| α-helix | 440-453 | 14 | |
| α-helix | 454-456 | 3 | |
| α-helix | 457-461 | 5 | |
| α-helix | 470-482 | 13 | |
| β-strand | 489 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Y+L amino acid transporter 1 | A | protein | 529 | Homo sapiens | Q9UM01 (AlphaFold model) |
>8XXI_1 Y+L amino acid transporter 1 (chains A) DYKDDDDKSGPDEVDASGRVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNG VCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGA SYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLA AACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSS FAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYY TVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREG HLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLY LRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIR VPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
| ID | Name | Formula | Copies |
|---|---|---|---|
| LEU | Leucine | C6 H13 N O2 | 1 |
Water and common crystallization additives (NA) are not listed.
Structural basis for the substrate recognition and transport mechanism of the human y + LAT1-4F2hc transporter complex. Dai, L., Zeng, Q., Zhang, T. et al. Sci Adv (2025) 11:eadq0558-eadq0558. DOI 10.1126/sciadv.adq0558 · PubMed
Other PDB entries of the same protein (UniProt Q9UM01 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8XXI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.