8Y0H: CXCR3

Structure of CXCR3 in complex with VUF11418 (Receptor-ligand focused map). Determined by electron microscopy at 3.53 Å resolution. Released 26 Feb 2025.

Method: Electron microscopy
Resolution: 3.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,198
Mol. weight: 47.07 kDa
Ligands: A1LW2
Released: 26 Feb 2025

Explore 8Y0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y0H contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	58-78	21
α-helix	87-103	17
α-helix	106-114	9
α-helix	120-153	34
α-helix	156-159	4
α-helix	169-188	20
β-strand	191-194	4	1
β-strand	201-204	4	1
α-helix	209-219	11
α-helix	220-224	5
α-helix	225-242	18
α-helix	250-282	33
α-helix	290-318	29
α-helix	323-334	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C chemokine receptor type 3	R	protein	424	Homo sapiens	P49682 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>8Y0H_1 C-X-C chemokine receptor type 3 (chains R)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSVLE
VSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLF
LLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLC
KVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFAL
PDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLV
SRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTS
GLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEAS
YSGL

Ligands and cofactors

ID	Name	Formula	Copies
A1LW2	[(1~{R},5~{S})-6,6-dimethyl-2-bicyclo[3.1.1]hept-2-enyl]methyl-[[4-(2-iodanylph…	C25 H31 I N	1

Primary citation

Structural visualization of small molecule recognition by CXCR3 uncovers dual-agonism in the CXCR3-CXCR7 system. Saha, S., Sano, F.K., Sharma, S. et al. Nat Commun (2025) 16:3047-3047. DOI 10.1038/s41467-025-58264-w · PubMed

Other PDB entries of the same protein (UniProt P49682 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HNM 2.94 Å, CXCR3-DNGi complex activated by VUF11222
9P0M 2.95 Å, Composite map of CXCL11-CXCR3-Gi-scFv16
8HNL 2.98 Å, CXCR3-DNGi complex activated by PS372424
8K2W 3.0 Å, Structure of CXCR3 complexed with antagonist AMG487
8HNK 3.01 Å, CXCR3-DNGi complex activated by CXCL11
8XYK 3.03 Å, Structure of CXCR3 in complex with VUF10661 and Go (Full map)
8Y0N 3.07 Å, Structure of CXCR3 in complex with VUF11418 and Go (Full map)
9P0L 3.1 Å, Composite map of CXCL10-CXCR3-Gi-scFv16
8XYI 3.16 Å, Structure of CXCR3 in complex with VUF10661 (Receptor-ligand focused map)
8K2X 3.2 Å, CXCR3-DNGi complex activated by CXCL10
8XXZ 3.3 Å, Structure of CXCR3 in the apo-state (Full map)
9P0K 3.5 Å, Composite map of CXCL9-CXCR3-Gi-scFv16

Browse structure collections

About this viewer

MolViewer shows 8Y0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.