8Y0P: Beta-Catenin

Beta-Catenin in complex with peptide 301. Determined by X-ray diffraction at 2.62 Å resolution. Released 17 Apr 2024.

Method: X-ray diffraction
Resolution: 2.62 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,755
Mol. weight: 123.92 kDa
Ligands: PRO
Released: 17 Apr 2024

Explore 8Y0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y0P contains 79 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 0 β-strands

Element	Residues	Length
α-helix	153-160	8
α-helix	165-178	14
α-helix	185-188	4
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-242	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-348	15
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-408	10
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-529	9
α-helix	532-548	17
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-661	13

Chain B: 40 helices, 0 β-strands

Element	Residues	Length
α-helix	153-160	8
α-helix	167-178	12
α-helix	182-188	7
α-helix	192-202	11
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-242	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-348	15
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-407	9
α-helix	408-410	3
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-548	17
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-661	13

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-26	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin beta-1	A, B	protein	549	Homo sapiens	P35222 (AlphaFold model)
B-cell CLL/lymphoma 9 protein	L	protein	24	Homo sapiens	O00512 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8Y0P_1 Catenin beta-1 (chains A, B)
NLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSA
IVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAIT
TLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILA
SGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRL
VQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMM
VCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKL
LHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQ
QQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGV
LCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVE
LTSSLFRTE

Sequence of entity 2 (L), FASTA

>8Y0P_2 B-cell CLL/lymphoma 9 protein (chains L)
LSQEQLEHRERSLQTLRDIQRMLA

Ligands and cofactors

ID	Name	Formula	Copies
PRO	Proline	C5 H9 N O2	4

Primary citation

Beta-Catenin in complex with peptide 301. Tim, F. To be published.

Other PDB entries of the same protein (UniProt P35222 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FQN 1.65 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
3FQR 1.7 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
7AFW 1.81 Å, Beta-Catenin in complex with compound 6
1JDH 1.9 Å, Crystal structure of beta-catenin and htcf-4
9I8K 2.0 Å, Beta-catenin armadillo (150-663)
9I8X 2.0 Å, Beta-catenin armadillo with cyclic peptide and Compound 2
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
29KL 2.09 Å, Crystal structure of Human Catenin Beta-1 in complex with cyclic beta sheet peptide…
1G3J 2.1 Å, Crystal structure of the XTCF3-cbd/beta-catenin armadillo repeat complex
1T08 2.1 Å, Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
3DIW 2.1 Å, c-terminal beta-catenin bound TIP-1 structure

Browse structure collections

About this viewer

MolViewer shows 8Y0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.