Structure of Vibrio vulnificus MARTX cysteine protease domain lacking beta-flap. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jul 2024.
Explore 8YJA in 3D Show helices and sheets RCSB PDB PDBe
8YJA contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3598-3600 | 3 | |
| α-helix | 3602-3603 | 2 | |
| β-strand | 3619-3624 | 6 | 1 |
| α-helix | 3629-3641 | 13 | |
| β-strand | 3646-3651 | 6 | 1 |
| β-strand | 3657-3661 | 5 | 1 |
| α-helix | 3664-3666 | 3 | |
| β-strand | 3671-3677 | 7 | 1 |
| β-strand | 3679-3684 | 6 | 2 |
| β-strand | 3687-3690 | 4 | 2 |
| β-strand | 3693 | 1 | 2 |
| α-helix | 3695-3713 | 19 | |
| β-strand | 3721-3726 | 6 | 1 |
| α-helix | 3732-3748 | 17 | |
| β-strand | 3754-3759 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3598-3600 | 3 | |
| α-helix | 3604-3606 | 3 | |
| β-strand | 3619-3624 | 6 | 1 |
| α-helix | 3629-3641 | 13 | |
| β-strand | 3646-3651 | 6 | 1 |
| β-strand | 3657-3661 | 5 | 1 |
| α-helix | 3664-3666 | 3 | |
| β-strand | 3671-3677 | 7 | 1 |
| β-strand | 3679-3681 | 3 | 3 |
| β-strand | 3688-3690 | 3 | 3 |
| β-strand | 3693 | 1 | 3 |
| α-helix | 3695-3713 | 19 | |
| β-strand | 3721-3726 | 6 | 1 |
| α-helix | 3732-3748 | 17 | |
| β-strand | 3754-3759 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MARTX cysteine protease domain | A, B | protein | 208 | Vibrio vulnificus MO6-24/O | A0A2S3R7M0 |
>8YJA_1 MARTX cysteine protease domain (chains A, B) GSAMGSILHNQNVNDWERVVVTPTADGGESRFDGQIIVQMENDDVVAKAAANLAGKHPES SVVVQIDSDGNYRVVYGDPSKLDGKLRWQLVGHGRDDSESNNTRLSGYSADELAVKLAKF QQSFNQAENINNKPDHISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRSSELAVD EAGRKHTKDANGDWVQKAENNKVSLSWD
| ID | Name | Formula | Copies |
|---|---|---|---|
| IHP | Inositol hexakisphosphate | C6 H18 O24 P6 | 1 |
Water and common crystallization additives (NA) are not listed.
Structural basis of the activation of MARTX cysteine protease domain from Vibrio vulnificus. Chen, L., Khan, H., Tan, L. et al. PLoS One (2024) 19:e0307512-e0307512. DOI 10.1371/journal.pone.0307512 · PubMed
Other PDB entries of the same protein (UniProt A0A2S3R7M0), best resolution first:
MolViewer shows 8YJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.