8YPE: Inactive p38

The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80. Determined by X-ray diffraction at 1.95 Å resolution. Released 19 Mar 2025.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 3,130
Mol. weight: 45.59 kDa
Released: 19 Mar 2025

Explore 8YPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YPE contains 24 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-7	6
β-strand	8-12	5	1
β-strand	17-21	5	1
β-strand	24-32	9	2
β-strand	36-43	8	2
β-strand	48-55	8	2
α-helix	62-77	16
β-strand	83	1	3
β-strand	88-90	3	2
β-strand	103-107	5	2
β-strand	111-112	2	3
α-helix	113-117	5
α-helix	121-123	3
α-helix	124-143	20
α-helix	153-155	3
β-strand	156-158	3	3
β-strand	164-166	3	3
α-helix	191-194	4
α-helix	203-218	16
α-helix	228-239	12
α-helix	244-249	6
α-helix	253-260	8
α-helix	263-264	2
α-helix	266-268	3
α-helix	270-273	4
α-helix	279-288	10
α-helix	293-295	3
α-helix	297-298	2
α-helix	299-303	5
α-helix	306-308	3
α-helix	314-316	3
α-helix	318-322	5
α-helix	326-329	4
α-helix	334-346	13
α-helix	350-352	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cyclic AMP-dependent transcription factor ATF-2	B	protein	35	Homo sapiens	P15336 (AlphaFold model)
Mitogen-activated protein kinase 14	A	protein	362	Mus musculus	P47811 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8YPE_1 Cyclic AMP-dependent transcription factor ATF-2 (chains B)
KHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCE

Sequence of entity 2 (A), FASTA

>8YPE_2 Mitogen-activated protein kinase 14 (chains A)
VHMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRP
FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK
CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDE
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRL
VGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRIT
AAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEM
ES

Primary citation

Structural and mechanistic insights into the allosteric activation of p38alpha MAP kinase via specific docking interactions. Zhang, Y.Y., Pei, C.J., He, Q.Q. et al. To be published.

Other PDB entries of the same protein (UniProt P15336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZQS 1.95 Å, Crystal structure of double-phosphorylated p38alpha with ATF2(83-102)
8YPF 2.0 Å, The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90
9Y0R 2.2 Å, Importin alpha 2 in complex with ATF2 basic region
6ZR5 2.7 Å, Crystal structure of JNK1 in complex with ATF2(19-58)
1T2K 3.0 Å, Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA
4H36 3.0 Å, Crystal Structure of JNK3 in Complex with ATF2 Peptide
1BHI Structure of transactivation domain of cre-BP1/ATF-2, NMR, 20 structures

Browse structure collections

About this viewer

MolViewer shows 8YPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.