8YTC: PML-RBCC dimer

PML-RBCC dimer. Determined by electron microscopy at 5.3 Å resolution. Released 26 Feb 2025.

Method: Electron microscopy
Resolution: 5.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,604
Mol. weight: 47.65 kDa
Released: 26 Feb 2025

Explore 8YTC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YTC contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	50-53	4
α-helix	80-83	4
α-helix	110-122	13
α-helix	127-130	4
α-helix	132-137	6
α-helix	150-157	8
α-helix	166-169	4
α-helix	175-182	8
β-strand	203-204	2	1
β-strand	209-210	2	1
α-helix	214-216	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PML	A, B	protein	211	Homo sapiens	P29590 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8YTC_1 Protein PML (chains A, B)
PASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALD
NVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARP
LAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSEL
KCDISAEIQQRQEELDAMTQALQEQDSAFGA

Primary citation

Cryo-EM structure of PML RBCC dimer reveals CC-mediated octopus-like nuclear body assembly mechanism. Tan, Y., Li, J., Zhang, S. et al. Cell Discov (2024) 10:118-118. DOI 10.1038/s41421-024-00735-3 · PubMed

Other PDB entries of the same protein (UniProt P29590 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UYR 1.3 Å, Crystal structure of K46-acetylated SUMO1 in complex with PML-SIM
6UYV 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYP 1.42 Å, Crystal structure of K39-acetylated SUMO1 in complex with PML-SIM
4WJO 1.46 Å, Crystal Structure of SUMO1 in complex with PML
4WJN 1.5 Å, Crystal structure of SUMO1 in complex with phosphorylated PML
6UYQ 1.5 Å, Crystal structure of K45-acetylated SUMO1 in complex with PML-SIM
6UYS 1.59 Å, Crystal structure of K37-acetylated SUMO1 in complex with phosphorylated PML-SIM
5YUF 1.6 Å, Crystal Structure of PML RING tetramer
6UYO 1.64 Å, Crystal structure of K37-acetylated SUMO1 in complex with PML-SIM
6UYU 1.66 Å, Crystal structure of K45-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYT 1.66 Å, Crystal structure of K39-acetylated SUMO1 in complex with phosphorylated PML-SIM
8DJH 1.77 Å, Ternary complex of SUMO1 with a phosphomimetic SIM of PML and zinc

Browse structure collections

About this viewer

MolViewer shows 8YTC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.