8YZQ: Galectin

Toxascaris leonina galectin (Tl-gal) W77F/W212F oligomer. Determined by X-ray diffraction at 2.15 Å resolution. Released 9 Apr 2025.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Toxascaris leonina
Chains: 8
Atoms: 17,893
Mol. weight: 251.34 kDa
Released: 9 Apr 2025

Explore 8YZQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YZQ contains 22 α-helices and 199 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	1
β-strand	24-30	7	2
β-strand	37-43	7	1
β-strand	54-61	8	1
β-strand	66-73	8	1
β-strand	76-77	2	1
β-strand	81-84	4	1
α-helix	87-88	2
β-strand	92-99	8	2
β-strand	103-108	6	2
β-strand	111-117	7	2
α-helix	122-124	3
β-strand	127-132	6	1
β-strand	135-142	8	2
β-strand	146	1	3
β-strand	150-153	4	4
β-strand	164-171	8	3
β-strand	177-184	8	4
β-strand	189-196	8	4
α-helix	197-199	3
β-strand	201-208	8	4
β-strand	211-212	2	4
β-strand	216	1	4
β-strand	229-235	7	3
β-strand	239-244	6	3
β-strand	247-253	7	3
β-strand	261-268	8	4
β-strand	270-277	8	3

Chain B: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	5
β-strand	24-30	7	6
β-strand	37-43	7	5
β-strand	54-61	8	5
β-strand	66-72	7	5
β-strand	77	1	5
β-strand	81-84	4	5
β-strand	93-99	7	6
β-strand	103-108	6	6
β-strand	111-117	7	6
α-helix	122-124	3
β-strand	127-132	6	5
β-strand	135-142	8	6
β-strand	146	1	7
β-strand	150-153	4	8
β-strand	164-171	8	7
β-strand	177-184	8	8
β-strand	189-196	8	8
β-strand	201-208	8	8
β-strand	211-212	2	8
β-strand	216	1	8
β-strand	229-235	7	7
β-strand	239-244	6	7
β-strand	247-253	7	7
β-strand	261-268	8	8
β-strand	270-277	8	7

Chain C: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	9
β-strand	24-30	7	10
β-strand	37-43	7	9
β-strand	54-61	8	9
β-strand	66-73	8	9
β-strand	76-77	2	9
β-strand	81-84	4	9
α-helix	87-88	2
β-strand	93-99	7	10
β-strand	103-108	6	10
β-strand	111-117	7	10
α-helix	122-124	3
β-strand	127-132	6	9
β-strand	135-142	8	10
β-strand	146	1	11
β-strand	150-153	4	12
β-strand	164-171	8	11
β-strand	177-184	8	12
β-strand	189-196	8	12
β-strand	201-208	8	12
β-strand	211-212	2	12
β-strand	216	1	12
β-strand	229-235	7	11
β-strand	239-244	6	11
β-strand	247-253	7	11
β-strand	261-268	8	12
β-strand	270-277	8	11

Chain D: 2 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	9
β-strand	24-30	7	13
β-strand	37-43	7	9
β-strand	54-61	8	9
β-strand	66-73	8	9
β-strand	76-77	2	9
β-strand	81-84	4	9
β-strand	93-99	7	13
β-strand	103-108	6	13
β-strand	111-117	7	13
α-helix	122-124	3
β-strand	127-132	6	9
β-strand	135-142	8	13
β-strand	150-153	4	14
β-strand	159	1	15
β-strand	163-171	9	16
β-strand	177-183	7	14
β-strand	189-196	8	14
β-strand	201-208	8	14
β-strand	211-212	2	14
β-strand	216	1	14
β-strand	229-235	7	16
β-strand	239-244	6	16
β-strand	247-253	7	16
β-strand	261	1	15
β-strand	263-268	6	14
β-strand	270-277	8	16

Chains E and F: 3 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	17
β-strand	24-30	7	18
β-strand	37-43	7	17
β-strand	54-61	8	17
β-strand	66-73	8	17
β-strand	76-77	2	17
β-strand	81-84	4	17
α-helix	87-88	2
β-strand	92-99	8	18
β-strand	103-108	6	18
β-strand	111-117	7	18
α-helix	122-124	3
β-strand	127-132	6	17
β-strand	135-142	8	18
β-strand	146	1	19
β-strand	150-153	4	20
β-strand	164-171	8	19
β-strand	177-184	8	20
β-strand	189-196	8	20
β-strand	201-208	8	20
β-strand	211-212	2	20
β-strand	216	1	20
β-strand	229-235	7	19
β-strand	239-244	6	19
β-strand	247-253	7	19
β-strand	261-268	8	20
β-strand	270-277	8	19

Chain G: 3 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	25
β-strand	24-30	7	26
β-strand	37-43	7	25
β-strand	54-61	8	25
β-strand	66-73	8	25
β-strand	76-77	2	25
β-strand	81-84	4	25
α-helix	87-88	2
β-strand	93-99	7	26
β-strand	103-108	6	26
β-strand	111-117	7	26
α-helix	122-124	3
β-strand	127-132	6	25
β-strand	135-142	8	26
β-strand	150-153	4	27
β-strand	164-171	8	28
β-strand	177-183	7	27
β-strand	189-196	8	27
β-strand	201-208	8	27
β-strand	211-212	2	27
β-strand	216	1	27
β-strand	229-235	7	28
β-strand	239-244	6	28
β-strand	247-253	7	28
β-strand	263-268	6	27
β-strand	270-277	8	28

Chain H: 4 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	17
β-strand	24-30	7	29
β-strand	37-43	7	17
β-strand	54-61	8	17
β-strand	66-73	8	17
β-strand	76-77	2	17
β-strand	81-84	4	17
α-helix	87-88	2
β-strand	93-99	7	29
β-strand	103-108	6	29
β-strand	111-117	7	29
α-helix	122-124	3
β-strand	127-132	6	17
β-strand	135-142	8	29
β-strand	150-153	4	30
β-strand	163-171	9	31
β-strand	177-184	8	30
β-strand	189-196	8	30
α-helix	197-199	3
β-strand	201-208	8	30
β-strand	211-212	2	30
β-strand	216	1	30
β-strand	229-235	7	31
β-strand	239-244	6	31
β-strand	247-253	7	31
β-strand	261-268	8	30
β-strand	270-277	8	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin	A, B, C, D, E, F, G, H	protein	278	Toxascaris leonina	A0A1L1QJZ7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>8YZQ_1 Galectin (chains A, B, C, D, E, F, G, H)
MATETNYPVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSADFSGNDVPLHISV
RFDEGKIVFNTFSKGEFGKEERKSNPYKKGDDIDIRIRAHDSKFSISVDQKEVKEYEHRV
PLSSVTHFSVDGDILITYIHWGGKYYPVPYESGLAGDGLAPGKSLLIFATPEKKGKRFHI
NLLKKNGDIALHFNPRFDEKAIVRNSLISGEFGNEEREGKNPLEKGIGCDLEFRNEEYAF
QIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV

Primary citation

Structure of mutant tl-galectin. Ha, M.S., Jang, S.B., Jeong, M.S. To be published.

Other PDB entries of the same protein (UniProt A0A1L1QJZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GM0 1.7 Å, Tl-gal with lactose
5GLV 1.8 Å, Tl-gal
5GLT 2.0 Å, Tl-gal with LNT
5GLW 2.0 Å, Tl-gal with LacNAc
5GLZ 2.0 Å, Tl-gal with Glucose
5GLU 2.1 Å, Tl-gal with SiaLac
8ZQI 2.98 Å, Glucose bound Toxascaris leonina galectin (Tl-gal) W77F/W212F
8HGJ 4.82 Å, Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3)…

Browse structure collections

About this viewer

MolViewer shows 8YZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.