8ZPY: Prefusion F of RSV

Crystal structure of prefusion F of RSV. Determined by X-ray diffraction at 2.92 Å resolution. Released 17 Dec 2025.

Method: X-ray diffraction
Resolution: 2.92 Å
Organisms: human respiratory syncytial virus, Enterobacteria phage T6
Chains: 6
Atoms: 20,848
Mol. weight: 343.87 kDa
Released: 17 Dec 2025

Explore 8ZPY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZPY contains 113 α-helices and 161 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	1
β-strand	38-49	12	1
β-strand	51-60	10	2
α-helix	64-65	2
β-strand	70	1	3
α-helix	74-98	25
β-strand	144	1	4
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	2
β-strand	186-194	9	2
α-helix	195-201	7
α-helix	204-207	4
β-strand	211	1	3
α-helix	212-214	3
α-helix	217-238	22
β-strand	243-244	2	2
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-284	7
β-strand	286-293	8	2
β-strand	296-305	10	2
β-strand	308-318	11	1
β-strand	321-322	2	5
α-helix	328-330	3
β-strand	333-336	4	5
β-strand	340-345	6	1
β-strand	348-352	5	1
β-strand	359-360	2	1
β-strand	364-368	5	1
α-helix	369-371	3
β-strand	373-375	3	1
α-helix	377-383	7
β-strand	394-398	5	5
β-strand	404-407	4	6
β-strand	411-416	6	6
β-strand	422-426	5	7
β-strand	430-434	5	7
α-helix	435-436	2
β-strand	438-443	6	6
β-strand	449-452	4	7
β-strand	455-458	4	7
α-helix	459-460	2
β-strand	464-469	6	1
α-helix	474-477	4
β-strand	490-491	2	5
α-helix	492-512	21

Chain B: 19 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	8
β-strand	38-60	23	8
α-helix	65-67	3
β-strand	70	1	9
α-helix	74-97	24
β-strand	144	1	10
α-helix	149-158	10
α-helix	163-173	11
β-strand	176-180	5	8
β-strand	186-194	9	8
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
β-strand	211	1	9
α-helix	212-216	5
α-helix	217-239	23
β-strand	243-244	2	8
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	8
β-strand	296-318	23	8
β-strand	321-322	2	11
α-helix	328-330	3
β-strand	333-336	4	11
β-strand	340-345	6	8
β-strand	348-352	5	8
β-strand	359-360	2	8
β-strand	364-368	5	8
α-helix	369-371	3
β-strand	373-375	3	8
α-helix	377-383	7
β-strand	394-398	5	11
β-strand	404-408	5	4
β-strand	411-416	6	4
β-strand	422-426	5	12
β-strand	430-434	5	12
α-helix	435-436	2
β-strand	438-443	6	4
β-strand	449-452	4	12
β-strand	455-458	4	12
α-helix	459-460	2
β-strand	465-469	5	8
α-helix	474-477	4
β-strand	490-491	2	11
α-helix	492-509	18

Chain C: 20 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	13
β-strand	38-49	12	13
β-strand	51-60	10	7
α-helix	64-65	2
α-helix	67	1
α-helix	74-94	21
β-strand	144	1	14
α-helix	149-158	10
α-helix	163-171	9
β-strand	176-181	6	7
β-strand	185-194	10	7
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
α-helix	212-216	5
α-helix	217-239	23
β-strand	243-244	2	7
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	7
β-strand	296-305	10	7
β-strand	308-318	11	13
β-strand	321-322	2	15
β-strand	333-336	4	15
β-strand	340-345	6	13
β-strand	348-352	5	13
β-strand	359-361	3	13
β-strand	364-368	5	13
α-helix	369-371	3
β-strand	373-375	3	13
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	15
β-strand	404-407	4	16
β-strand	411-416	6	16
β-strand	422-426	5	17
β-strand	430-434	5	17
α-helix	435-436	2
β-strand	438-443	6	16
β-strand	449-452	4	17
β-strand	455-458	4	17
α-helix	459-460	2
β-strand	465-469	5	13
α-helix	474-477	4
β-strand	490-491	2	15
α-helix	492-511	20

Chain D: 19 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	18
β-strand	38-49	12	18
β-strand	51-60	10	19
α-helix	74-97	24
β-strand	144	1	16
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-180	5	19
β-strand	186-194	9	19
α-helix	195-197	3
α-helix	198-203	6
α-helix	204-207	4
α-helix	212-216	5
α-helix	217-240	24
β-strand	243-244	2	19
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	19
β-strand	296-305	10	19
β-strand	308-318	11	18
β-strand	321-322	2	20
β-strand	333-336	4	20
β-strand	340-345	6	18
β-strand	348-352	5	18
α-helix	355-357	3
β-strand	358-361	4	18
β-strand	364-368	5	18
α-helix	369-371	3
β-strand	373-375	3	18
α-helix	377-380	4
α-helix	381-384	4
β-strand	395-398	4	20
β-strand	404-408	5	21
β-strand	411-416	6	21
β-strand	422-426	5	22
β-strand	430-434	5	22
β-strand	438-443	6	21
β-strand	449-452	4	22
β-strand	455-458	4	22
α-helix	459-460	2
β-strand	465-469	5	18
α-helix	474-476	3
α-helix	492-515	24

Chain E: 19 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	23
β-strand	38-60	23	23
α-helix	74-97	24
β-strand	144	1	6
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	23
β-strand	186-194	9	23
α-helix	195-198	4
α-helix	199-203	5
α-helix	213-216	4
α-helix	217-240	24
β-strand	243-244	2	23
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	23
β-strand	296-318	23	23
β-strand	321-322	2	24
β-strand	333-336	4	24
β-strand	340-345	6	23
β-strand	348-352	5	23
α-helix	355-357	3
β-strand	359-361	3	23
β-strand	364-368	5	23
α-helix	369-371	3
β-strand	373-375	3	23
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	24
β-strand	404-407	4	10
β-strand	411-416	6	10
β-strand	422-426	5	25
β-strand	430-434	5	25
α-helix	435-436	2
β-strand	438-443	6	10
β-strand	449-452	4	25
β-strand	455-458	4	25
β-strand	465-469	5	23
α-helix	474-477	4
β-strand	490-491	2	24
α-helix	492-511	20
α-helix	513-515	3

Chain F: 18 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	26
β-strand	38-49	12	26
β-strand	51-60	10	27
α-helix	74-97	24
β-strand	144	1	21
α-helix	149-158	10
α-helix	164-170	7
β-strand	176-180	5	27
β-strand	186-194	9	27
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
α-helix	212-215	4
α-helix	217-238	22
β-strand	243-244	2	27
α-helix	247-248	2
α-helix	254-261	8
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	27
β-strand	296-305	10	27
β-strand	308-318	11	26
β-strand	321-322	2	28
β-strand	333-336	4	28
β-strand	340-345	6	26
β-strand	348-352	5	26
α-helix	355-357	3
β-strand	358-361	4	26
β-strand	364-368	5	26
α-helix	369-371	3
β-strand	373-375	3	26
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	28
β-strand	404-408	5	14
β-strand	411-416	6	14
β-strand	422-426	5	23
β-strand	430-434	5	23
β-strand	438-443	6	14
β-strand	449-452	4	23
β-strand	455-458	4	23
β-strand	464-469	6	26
β-strand	490-491	2	28
α-helix	492-512	21
α-helix	513-516	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0,Fibritin	A, B, C, D, E, F	protein	522	human respiratory syncytial virus, Enterobacteria phage T6	A0A346FJN8, P12568

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>8ZPY_1 Fusion glycoprotein F0,Fibritin (chains A, B, C, D, E, F)
MKCLLYLAFLFIGVNCQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEPKC
NGTDAKVKLIKQELDKYKNAVTELQLLMQSGGGGSGGGGSGGGGSRFPPFPLGVGSAIAS
GVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVPIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGS
NICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPPEVNLCNVDIFNPK
YDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTV
SVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
ELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLHHHHHHHH

Primary citation

prefusion F of RSV. Huang, Q., Lang, Q., Han, X. et al. To be published.

Other PDB entries of the same protein (UniProt A0A346FJN8), best resolution first:

9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
8ZQ6 2.77 Å, preF6P of RSV glycoprotein
8ZQ7 2.77 Å, Crystal structure of prefusion RSV F protein
9UE3 2.78 Å, The structure of FIPV spike glycoprotein
8WLU 2.87 Å, Cryo-EM structure of bat RsSHC014 spike glycoprotein
9VWF 3.14 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12
8ZHE 3.16 Å, SARS-CoV-2 spike trimer (6P) in complex with three R1-26 Fabs
8ZHM 3.39 Å, SARS-CoV-2 spike trimer (6P) in complex with three H18 and three R1-32 Fabs
8ZHD 3.41 Å, SARS-CoV-2 spike trimer (6P) in complex with two R1-26 Fabs
8ZHG 3.51 Å, SARS-CoV-2 spike trimer (6P) in complex with R1-26 Fab, focused refinement of RBD-Fab…
8WLY 3.96 Å, Cryo-EM structure of bat WIV1 spike glycoprotein
8ZHL 3.96 Å, SARS-CoV-2 spike trimer (6P) in complex with two H18 and two R1-32 Fabs

Browse structure collections

About this viewer

MolViewer shows 8ZPY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.