9VWF: RSV pre-F

Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12. Determined by electron microscopy at 3.14 Å resolution. Released 22 Jul 2026.

Method: Electron microscopy
Resolution: 3.14 Å
Organisms: Respiratory syncytial virus A2, Enterobacteria phage T6, Homo sapiens
Chains: 9
Atoms: 15,258
Mol. weight: 264.63 kDa
Released: 22 Jul 2026

Explore 9VWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VWF contains 45 α-helices and 150 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 15 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	30-33	4	1
β-strand	38-41	4	1
β-strand	45-49	5	2
β-strand	52-60	9	3
α-helix	74-96	23
α-helix	150-158	9
α-helix	165-170	6
β-strand	176-180	5	3
β-strand	186-194	9	3
α-helix	196-198	3
α-helix	199-203	5
α-helix	204-207	4
α-helix	217-240	24
β-strand	243-244	2	3
α-helix	254-260	7
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-291	6	3
β-strand	296-304	9	3
β-strand	308-312	5	2
β-strand	313-318	6	1
β-strand	333-336	4	4
β-strand	340-344	5	1
β-strand	349-352	4	1
β-strand	358-361	4	2
β-strand	364-368	5	2
β-strand	373-375	3	1
α-helix	381-384	4
β-strand	394-398	5	4
β-strand	404-407	4	5
β-strand	411-416	6	5
β-strand	422-426	5	6
β-strand	430-434	5	6
β-strand	438-443	6	5
β-strand	449-452	4	6
β-strand	455-458	4	6
α-helix	459-460	2
β-strand	466-469	4	1
α-helix	474-477	4
α-helix	480-482	3
β-strand	490-491	2	4
α-helix	492-507	16

Chains D, E and H: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	20
β-strand	19-25	7	20
β-strand	34-39	6	21
β-strand	45-50	6	21
β-strand	60	1	21
β-strand	68-73	6	20
β-strand	78-83	6	20
β-strand	92-94	3	22
β-strand	95-99	5	21
β-strand	109-112	4	21
β-strand	116-118	3	22

Chains F, G and L: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	23
β-strand	17-20	4	24
β-strand	23	1	23
β-strand	37-40	4	25
β-strand	47-51	5	25
β-strand	55-56	2	25
β-strand	64-67	4	24
β-strand	72	1	23
β-strand	74-78	5	24
β-strand	87-89	3	25
β-strand	91-94	4	26
β-strand	99-102	4	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0,Fibritin	A, B, C	protein	570	Respiratory syncytial virus A2, Enterobacteria phage T6	A0A346FJN8, P03420
3G12 heavy chain	D, E, H	protein	122	Homo sapiens
3G12 light chain	F, G, L	protein	111	Homo sapiens

Sequence of entity 1 (A, B, C), FASTA

>9VWF_1 Fusion glycoprotein F0,Fibritin (chains A, B, C)
ATMELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLGALRTGWYTSVIT
IELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTDLQLLMQSTPATNNRARRELPRFMNYT
LNNAKKTNVTLSKKRKRRFLGFLLGSGSAICSGVAVCKVLHLEGEVNKIKSALLSTNKAV
VSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSIPNIETVIEFQQKNNRLLEITREFS
VNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLA
YVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETC
KVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYG
KTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYCVNKQEGQSLYVKGEPIINFY
DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWV
LLSTFLGGLVPRGSHHHHHHSAWSHPQFEK

Sequence of entity 2 (D, E, H), FASTA

>9VWF_2 3G12 heavy chain (chains D, E, H)
EAQLVESGGDSVKPGGSLRLSCVGYGLMISDHWMHWVRQVPGKGLVWVARISSDGSRATY
ADSVKGRFSISRDNAKDKLFLQMNSLRAEDTAIYYCAREHLWFGEGNALDIWGLGTVVTV
SS

Sequence of entity 3 (F, G, L), FASTA

>9VWF_3 3G12 light chain (chains F, G, L)
QSVLTQPPSVSGAPGQSVIISCTGSSSNTGAGFDVQWHQQLPGTAPKLLIYTNHNRASGV
PDRFSASKSGTSASLAINGLQAEDEGVYYCQSYDRDLSGLVFGGGTKLTVL

Primary citation

Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12. Liu, L., Sun, P., Li, S. et al. To be published.

Other PDB entries of the same protein (UniProt A0A346FJN8), best resolution first:

9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
8ZQ6 2.77 Å, preF6P of RSV glycoprotein
8ZQ7 2.77 Å, Crystal structure of prefusion RSV F protein
9UE3 2.78 Å, The structure of FIPV spike glycoprotein
8WLU 2.87 Å, Cryo-EM structure of bat RsSHC014 spike glycoprotein
8ZPY 2.92 Å, Crystal structure of prefusion F of RSV
8ZHE 3.16 Å, SARS-CoV-2 spike trimer (6P) in complex with three R1-26 Fabs
8ZHM 3.39 Å, SARS-CoV-2 spike trimer (6P) in complex with three H18 and three R1-32 Fabs
8ZHD 3.41 Å, SARS-CoV-2 spike trimer (6P) in complex with two R1-26 Fabs
8ZHG 3.51 Å, SARS-CoV-2 spike trimer (6P) in complex with R1-26 Fab, focused refinement of RBD-Fab…
8WLY 3.96 Å, Cryo-EM structure of bat WIV1 spike glycoprotein
8ZHL 3.96 Å, SARS-CoV-2 spike trimer (6P) in complex with two H18 and two R1-32 Fabs

Browse structure collections

About this viewer

MolViewer shows 9VWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.