8ZQ7: Prefusion RSV F protein

Crystal structure of prefusion RSV F protein. Determined by X-ray diffraction at 2.77 Å resolution. Released 4 Jun 2025.

Method: X-ray diffraction
Resolution: 2.77 Å
Organisms: human respiratory syncytial virus, Enterobacteria phage T6
Chains: 6
Atoms: 21,095
Mol. weight: 343.77 kDa
Released: 4 Jun 2025

Explore 8ZQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZQ7 contains 105 α-helices and 154 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
β-strand	38-49	12	1
β-strand	51-60	10	2
α-helix	74-97	24
α-helix	136-139	4
β-strand	144	1	3
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	2
β-strand	186-194	9	2
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
α-helix	213-216	4
α-helix	217-238	22
β-strand	243-244	2	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	2
β-strand	296-305	10	2
β-strand	308-318	11	1
β-strand	321-322	2	4
β-strand	333-336	4	4
β-strand	340-345	6	1
β-strand	348-352	5	1
β-strand	358-361	4	1
β-strand	364-368	5	1
α-helix	369-371	3
β-strand	373-375	3	1
α-helix	377-383	7
β-strand	395-398	4	4
β-strand	404-407	4	5
β-strand	411-416	6	5
β-strand	422-426	5	6
β-strand	430-434	5	6
β-strand	438-443	6	5
β-strand	449-452	4	6
β-strand	455-458	4	6
α-helix	459-460	2
β-strand	465-469	5	1
α-helix	474-477	4
α-helix	480-482	3
α-helix	492-514	23

Chain B: 16 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	6
β-strand	38-60	23	6
α-helix	74-97	24
β-strand	144	1	7
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-180	5	6
β-strand	186-194	9	6
α-helix	195-202	8
α-helix	214-216	3
α-helix	217-238	22
β-strand	243-244	2	6
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	6
β-strand	296-318	23	6
β-strand	321-322	2	8
β-strand	333-336	4	8
β-strand	340-345	6	6
β-strand	348-352	5	6
α-helix	355-357	3
β-strand	358-361	4	6
β-strand	364-368	5	6
α-helix	369-371	3
β-strand	373-375	3	6
α-helix	377-383	7
β-strand	395-398	4	8
β-strand	404-407	4	9
β-strand	411-416	6	9
β-strand	422-426	5	10
β-strand	430-434	5	10
α-helix	435-436	2
β-strand	438-443	6	9
β-strand	449-452	4	10
β-strand	455-458	4	10
α-helix	459-460	2
β-strand	465-469	5	6
α-helix	474-477	4
α-helix	492-515	24

Chain C: 18 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	11
β-strand	38-49	12	11
β-strand	51-60	10	12
α-helix	74-99	26
β-strand	144	1	5
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-180	5	12
β-strand	186-194	9	12
α-helix	195-197	3
α-helix	198-203	6
α-helix	204-207	4
α-helix	212-216	5
α-helix	217-238	22
β-strand	243-244	2	12
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	12
β-strand	296-305	10	12
β-strand	308-318	11	11
β-strand	321-322	2	13
β-strand	333-336	4	13
β-strand	340-345	6	11
β-strand	348-352	5	11
β-strand	359-361	3	11
β-strand	364-368	5	11
α-helix	369-371	3
β-strand	373-375	3	11
α-helix	377-383	7
β-strand	394-398	5	13
β-strand	404-407	4	14
β-strand	411-416	6	14
β-strand	422-426	5	15
β-strand	430-434	5	15
α-helix	435-436	2
β-strand	438-443	6	14
β-strand	449-452	4	15
β-strand	455-458	4	15
α-helix	459-460	2
β-strand	465-469	5	11
α-helix	474-477	4
β-strand	490-491	2	13
α-helix	492-514	23

Chain D: 18 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	16
β-strand	38-48	11	16
β-strand	49	1	17
β-strand	51-60	10	18
α-helix	74-97	24
β-strand	144	1	9
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	18
β-strand	186-194	9	18
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
α-helix	212-216	5
α-helix	217-239	23
β-strand	243-244	2	18
α-helix	247-248	2
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	18
β-strand	296-305	10	18
β-strand	308-318	11	16
β-strand	321-322	2	19
β-strand	333-336	4	19
β-strand	340-345	6	16
β-strand	348-352	5	16
β-strand	359-361	3	16
β-strand	364-366	3	16
β-strand	368	1	17
α-helix	369-371	3
β-strand	373-375	3	16
α-helix	377-383	7
β-strand	394-398	5	19
β-strand	404-407	4	20
β-strand	411-416	6	20
β-strand	422-426	5	21
β-strand	430-434	5	21
α-helix	435-436	2
β-strand	438-443	6	20
β-strand	449-452	4	21
β-strand	455-458	4	21
β-strand	465-469	5	16
α-helix	474-477	4
α-helix	480-482	3
β-strand	487-491	5	19
α-helix	492-515	24

Chain E: 16 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	22
β-strand	38-60	23	22
α-helix	74-97	24
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	22
β-strand	186-194	9	22
α-helix	195-197	3
α-helix	198-203	6
α-helix	204-207	4
α-helix	213-216	4
α-helix	217-239	23
β-strand	243-244	2	22
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	22
β-strand	296-318	23	22
β-strand	321-322	2	23
β-strand	333-336	4	23
β-strand	340-345	6	22
β-strand	348-352	5	22
α-helix	355-357	3
β-strand	358-361	4	22
β-strand	364-368	5	22
α-helix	369-371	3
β-strand	373-375	3	22
α-helix	377-383	7
β-strand	394-398	5	23
β-strand	404-407	4	7
β-strand	411-416	6	7
β-strand	422-426	5	24
β-strand	430-434	5	24
β-strand	438-443	6	7
β-strand	449-452	4	24
β-strand	455-458	4	24
β-strand	465-469	5	22
α-helix	474-477	4
β-strand	490-491	2	23
α-helix	492-514	23

Chain F: 19 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	25
β-strand	38-60	23	25
α-helix	74-97	24
β-strand	144	1	14
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-180	5	25
β-strand	186-194	9	25
α-helix	195-198	4
α-helix	199-203	5
α-helix	213-216	4
α-helix	217-239	23
β-strand	243-244	2	25
α-helix	247-248	2
α-helix	254-263	10
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	25
β-strand	296-318	23	25
β-strand	321-322	2	26
β-strand	333-336	4	26
β-strand	340-345	6	25
β-strand	348-352	5	25
β-strand	359-361	3	25
β-strand	364-368	5	25
α-helix	369-371	3
β-strand	373-375	3	25
α-helix	377-380	4
α-helix	381-384	4
β-strand	395-398	4	26
β-strand	404-407	4	3
β-strand	411-416	6	3
β-strand	422-426	5	27
β-strand	430-434	5	27
α-helix	435-436	2
β-strand	438-443	6	3
β-strand	449-452	4	27
β-strand	455-458	4	27
α-helix	459-460	2
β-strand	465-469	5	25
α-helix	474-477	4
α-helix	480-482	3
α-helix	492-515	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0,Fibritin	A, B, C, D, E, F	protein	522	human respiratory syncytial virus, Enterobacteria phage T6	A0A346FJN8, P12568

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>8ZQ7_1 Fusion glycoprotein F0,Fibritin (chains A, B, C, D, E, F)
MKCLLYLAFLFIGVNCQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEPKC
NGTDAKVKLIKQELDKYKNAVTELQLLMQSGGGGSGGGGSGGGGSRFPPFPLGVGSAIAS
GVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSIPPIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVPIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGS
NICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPPEVNLCNVDIFNPK
YDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTV
SVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD
ELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLHHHHHHHH

Primary citation

preF8P of RSV glycoprotein F0. Huang, Q., Lang, Q., Han, X. et al. To be published.

Other PDB entries of the same protein (UniProt A0A346FJN8), best resolution first:

9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
8ZQ6 2.77 Å, preF6P of RSV glycoprotein
9UE3 2.78 Å, The structure of FIPV spike glycoprotein
8WLU 2.87 Å, Cryo-EM structure of bat RsSHC014 spike glycoprotein
8ZPY 2.92 Å, Crystal structure of prefusion F of RSV
9VWF 3.14 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12
8ZHE 3.16 Å, SARS-CoV-2 spike trimer (6P) in complex with three R1-26 Fabs
8ZHM 3.39 Å, SARS-CoV-2 spike trimer (6P) in complex with three H18 and three R1-32 Fabs
8ZHD 3.41 Å, SARS-CoV-2 spike trimer (6P) in complex with two R1-26 Fabs
8ZHG 3.51 Å, SARS-CoV-2 spike trimer (6P) in complex with R1-26 Fab, focused refinement of RBD-Fab…
8WLY 3.96 Å, Cryo-EM structure of bat WIV1 spike glycoprotein
8ZHL 3.96 Å, SARS-CoV-2 spike trimer (6P) in complex with two H18 and two R1-32 Fabs

Browse structure collections

About this viewer

MolViewer shows 8ZQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.