8ZQI: Galectin

Glucose bound Toxascaris leonina galectin (Tl-gal) W77F/W212F. Determined by X-ray diffraction at 2.98 Å resolution. Released 4 Jun 2025.

Method: X-ray diffraction
Resolution: 2.98 Å
Organism: Toxascaris leonina
Chains: 8
Atoms: 17,856
Mol. weight: 252.78 kDa
Ligands: BGC
Released: 4 Jun 2025

Explore 8ZQI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZQI contains 19 α-helices and 213 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 28 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	1
β-strand	24-30	7	2
β-strand	37-43	7	1
β-strand	54-61	8	1
β-strand	66-72	7	1
β-strand	73	1	3
β-strand	76	1	3
β-strand	81-84	4	1
β-strand	92-99	8	2
β-strand	103-108	6	2
β-strand	111-117	7	2
α-helix	122-124	3
β-strand	127-132	6	1
β-strand	135-142	8	2
β-strand	146	1	4
β-strand	150-153	4	5
β-strand	159	1	6
β-strand	163-171	9	4
β-strand	177-183	7	5
β-strand	189-196	8	5
β-strand	201-208	8	5
β-strand	211-212	2	5
β-strand	216	1	5
β-strand	229-235	7	4
β-strand	239-244	6	4
β-strand	247-253	7	4
β-strand	261	1	6
β-strand	263-268	6	5
β-strand	270-277	8	4

Chain B: 3 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	7
α-helix	15	1
β-strand	24-30	7	8
β-strand	37-43	7	7
β-strand	54-61	8	7
β-strand	66-73	8	7
β-strand	76-77	2	7
β-strand	81-84	4	7
β-strand	93-99	7	8
β-strand	103-108	6	8
β-strand	111-117	7	8
α-helix	122-124	3
β-strand	127-132	6	7
β-strand	135-142	8	8
β-strand	150-153	4	9
β-strand	164-171	8	10
β-strand	177-183	7	9
β-strand	189-196	8	9
β-strand	201-208	8	9
β-strand	211-212	2	9
β-strand	216	1	9
β-strand	229-235	7	10
β-strand	239-244	6	10
β-strand	247-253	7	10
β-strand	263-268	6	9
β-strand	270-277	8	10

Chain C: 3 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	11
β-strand	24-30	7	12
β-strand	37-43	7	11
β-strand	54-61	8	11
β-strand	66-72	7	11
β-strand	73	1	13
β-strand	76	1	13
α-helix	79-80	2
β-strand	81-84	4	11
β-strand	92-99	8	12
β-strand	103-108	6	12
β-strand	112-117	6	12
α-helix	122-124	3
β-strand	127-132	6	11
β-strand	135-142	8	12
β-strand	146	1	14
β-strand	150-153	4	15
β-strand	159	1	15
β-strand	163-171	9	14
β-strand	177-184	8	15
β-strand	189-196	8	15
β-strand	201-208	8	15
β-strand	211-212	2	15
β-strand	216	1	15
β-strand	229-235	7	14
β-strand	239-244	6	14
β-strand	247-253	7	14
β-strand	261-268	8	15
β-strand	270-277	8	14

Chain D: 3 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	7
β-strand	24-30	7	16
β-strand	37-43	7	7
β-strand	54-61	8	7
β-strand	66-73	8	7
β-strand	76-77	2	7
β-strand	81-84	4	7
α-helix	87-88	2
β-strand	93-99	7	16
β-strand	103-108	6	16
β-strand	111-117	7	16
α-helix	122-124	3
β-strand	127-132	6	7
β-strand	135-142	8	16
β-strand	146	1	17
β-strand	150-153	4	18
β-strand	159	1	19
β-strand	163-171	9	17
β-strand	177-183	7	18
β-strand	189-196	8	18
β-strand	201-208	8	18
β-strand	211-212	2	18
β-strand	216	1	18
β-strand	229-235	7	17
β-strand	239-244	6	17
β-strand	247-253	7	17
β-strand	261	1	19
β-strand	263-268	6	18
β-strand	270-277	8	17

Chain E: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	20
β-strand	24-30	7	21
β-strand	37-44	8	20
β-strand	52-61	10	20
β-strand	66-73	8	20
β-strand	76-77	2	20
α-helix	79-80	2
β-strand	81-84	4	20
β-strand	93-98	6	21
β-strand	103-108	6	21
β-strand	112-117	6	21
α-helix	122-124	3
β-strand	127-132	6	20
β-strand	135-142	8	21
β-strand	146	1	22
β-strand	150-153	4	23
β-strand	159	1	23
β-strand	164-171	8	22
β-strand	177-184	8	23
β-strand	189-196	8	23
β-strand	201-208	8	23
β-strand	211-212	2	23
β-strand	216	1	23
β-strand	220	1	23
β-strand	224	1	24
β-strand	227	1	24
β-strand	229-235	7	22
β-strand	239-244	6	22
β-strand	247-253	7	22
β-strand	261-268	8	23
β-strand	270-277	8	22

Chain F: 1 helix, 25 β-strands

Element	Residues	Length	Sheet
β-strand	11-14	4	25
β-strand	23-30	8	26
β-strand	37-43	7	25
β-strand	54-61	8	25
β-strand	66-73	8	25
β-strand	76-77	2	25
β-strand	81-84	4	25
β-strand	92-99	8	26
β-strand	103-108	6	26
β-strand	111-117	7	26
α-helix	122-124	3
β-strand	127-132	6	25
β-strand	135-143	9	26
β-strand	146	1	27
β-strand	150-153	4	28
β-strand	164-171	8	27
β-strand	177-183	7	28
β-strand	189-196	8	28
β-strand	201-208	8	28
β-strand	211-212	2	28
β-strand	216	1	28
β-strand	229-235	7	27
β-strand	239-244	6	27
β-strand	247-253	7	27
β-strand	263-268	6	28
β-strand	270-277	8	27

Chain G: 3 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	25
β-strand	24-30	7	29
β-strand	37-43	7	25
β-strand	54-61	8	25
β-strand	66-73	8	25
β-strand	76-77	2	25
α-helix	79-80	2
β-strand	81-84	4	25
β-strand	92-99	8	29
β-strand	103-108	6	29
β-strand	111-117	7	29
α-helix	122-124	3
β-strand	127-132	6	25
β-strand	135-142	8	29
β-strand	146	1	30
β-strand	150-153	4	31
β-strand	159	1	32
β-strand	163-171	9	30
β-strand	177-183	7	31
β-strand	189-196	8	31
β-strand	201-208	8	31
β-strand	211-212	2	31
β-strand	216	1	31
β-strand	229-235	7	30
β-strand	239-244	6	30
β-strand	248-253	6	30
β-strand	261	1	32
β-strand	263-268	6	31
β-strand	270-277	8	30

Chain H: 2 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	11-14	4	33
β-strand	24-30	7	34
β-strand	37-43	7	33
β-strand	54-61	8	33
β-strand	66-73	8	33
β-strand	76-77	2	33
β-strand	81-84	4	33
β-strand	93-99	7	34
β-strand	103-108	6	34
β-strand	111-117	7	34
α-helix	122-124	3
β-strand	127-132	6	33
β-strand	135-142	8	34
β-strand	146	1	35
β-strand	150-153	4	36
β-strand	159	1	36
β-strand	164-171	8	35
β-strand	177-184	8	36
β-strand	189-196	8	36
β-strand	201-208	8	36
β-strand	211-212	2	36
β-strand	216	1	36
β-strand	229-235	7	35
β-strand	239-244	6	35
β-strand	247-253	7	35
β-strand	261-268	8	36
β-strand	270-277	8	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin	A, B, C, D, E, F, G, H	protein	278	Toxascaris leonina	A0A1L1QJZ7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>8ZQI_1 Galectin (chains A, B, C, D, E, F, G, H)
MATETNYPVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSADFSGNDVPLHISV
RFDEGKIVFNTFSKGEFGKEERKSNPYKKGDDIDIRIRAHDSKFSISVDQKEVKEYEHRV
PLSSVTHFSVDGDILITYIHWGGKYYPVPYESGLAGDGLAPGKSLLIFATPEKKGKRFHI
NLLKKNGDIALHFNPRFDEKAIVRNSLISGEFGNEEREGKNPLEKGIGCDLEFRNEEYAF
QIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV

Ligands and cofactors

ID	Name	Formula	Copies
BGC	beta-D-glucopyranose	C6 H12 O6	8

Primary citation

Structure of glucose bound mutant tl-galectin. Ha, M.S., Jang, S.B., Jeong, M.S. To be published.

Other PDB entries of the same protein (UniProt A0A1L1QJZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GM0 1.7 Å, Tl-gal with lactose
5GLV 1.8 Å, Tl-gal
5GLT 2.0 Å, Tl-gal with LNT
5GLW 2.0 Å, Tl-gal with LacNAc
5GLZ 2.0 Å, Tl-gal with Glucose
5GLU 2.1 Å, Tl-gal with SiaLac
8YZQ 2.15 Å, Toxascaris leonina galectin (Tl-gal) W77F/W212F oligomer
8HGJ 4.82 Å, Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3)…

Browse structure collections

About this viewer

MolViewer shows 8ZQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.