8ZRN: Abt

Structure of abt. Determined by electron microscopy at 3.25 Å resolution. Released 30 Apr 2025.

Method: Electron microscopy
Resolution: 3.25 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 5
Atoms: 15,997
Mol. weight: 331.28 kDa
Ligands: A1D8V
Released: 30 Apr 2025

Explore 8ZRN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZRN contains 52 α-helices and 96 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	33-41	9
β-strand	59-61	3	1
β-strand	62-72	11	2
β-strand	80-89	10	2
β-strand	90-91	2	3
β-strand	110	1	4
β-strand	120-122	3	5
β-strand	125	1	2
β-strand	138	1	4
β-strand	145-146	2	3
β-strand	151-156	6	2
β-strand	169-170	2	6
β-strand	173-178	6	5
β-strand	186-188	3	1
β-strand	196	1	2
β-strand	206-208	3	6
β-strand	212-218	7	5
β-strand	227-233	7	5
β-strand	236-238	3	6
α-helix	242-247	6
α-helix	249-257	9
α-helix	258-262	5
α-helix	271-292	22
α-helix	302-328	27
α-helix	340-352	13
α-helix	652-700	49
α-helix	702-705	4

Chain B: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	25-32	8
α-helix	33-37	5
β-strand	54-58	5	7
β-strand	61	1	8
β-strand	62	1	9
β-strand	67-69	3	10
β-strand	74-76	3	10
β-strand	79-80	2	9
β-strand	83-84	2	7
β-strand	85-86	2	11
β-strand	102-103	2	11
β-strand	106	1	12
α-helix	107-109	3
β-strand	115-117	3	13
β-strand	132	1	12
β-strand	135-136	2	11
β-strand	140-141	2	11
β-strand	146-147	2	9
β-strand	150-152	3	10
β-strand	164-173	10	13
β-strand	181-185	5	7
β-strand	191	1	8
β-strand	201-205	5	13
β-strand	208-211	4	13
β-strand	221-230	10	13
α-helix	233-235	3
α-helix	236-240	5
α-helix	241-247	7
α-helix	252-254	3
α-helix	263-281	19
α-helix	295-320	26
α-helix	331-335	5
α-helix	336-340	5
α-helix	341-344	4
α-helix	521-572	52

Chain C: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	34-41	8
α-helix	58	1
β-strand	59	1	14
α-helix	60	1
β-strand	62-64	3	15
β-strand	66	1	16
β-strand	67-74	8	17
β-strand	79-85	7	17
β-strand	87-90	4	15
β-strand	108-110	3	15
β-strand	120-122	3	18
β-strand	125	1	17
α-helix	132-133	2
β-strand	138-140	3	15
β-strand	146-148	3	15
β-strand	151-157	7	17
β-strand	169-170	2	18
β-strand	174-178	5	18
β-strand	186	1	14
β-strand	189-190	2	15
β-strand	196	1	16
β-strand	206-219	14	18
β-strand	226-238	13	18
α-helix	248-257	10
α-helix	259-263	5
α-helix	271-291	21
α-helix	302-328	27
α-helix	349-352	4
α-helix	652-702	51

Chain D: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	27-34	8
β-strand	54	1	19
β-strand	57-69	13	20
β-strand	74-91	18	20
β-strand	103-106	4	20
β-strand	115-117	3	21
α-helix	126-130	5
β-strand	132-135	4	20
β-strand	138-143	6	20
β-strand	146-152	7	20
β-strand	164-173	10	21
β-strand	181	1	19
β-strand	184-185	2	20
β-strand	189	1	22
α-helix	190	1
β-strand	191	1	20
β-strand	201	1	23
β-strand	205	1	21
β-strand	207	1	22
β-strand	208-212	5	21
β-strand	220-229	10	21
β-strand	230	1	23
α-helix	240-251	12
α-helix	252-254	3
α-helix	263-281	19
α-helix	295-320	26
α-helix	331-335	5
α-helix	336-340	5
α-helix	341-344	4
α-helix	520-569	50

Chain E: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	26-37	12
β-strand	54-67	14	24
β-strand	74	1	25
β-strand	76-86	11	24
β-strand	105-106	2	26
β-strand	115-117	3	27
β-strand	132-133	2	26
β-strand	134-135	2	24
β-strand	140-143	4	24
β-strand	146-149	4	24
β-strand	152	1	25
α-helix	154-156	3
β-strand	164	1	28
β-strand	168-173	6	27
β-strand	181-185	5	24
β-strand	191	1	24
α-helix	195-198	4
β-strand	202-205	4	28
β-strand	208-212	5	27
β-strand	220-225	6	27
β-strand	227-229	3	28
α-helix	242-255	14
α-helix	263-284	22
α-helix	296-320	25
α-helix	331-336	6
α-helix	341-344	4
α-helix	521-569	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal acetylcholine receptor subunit alpha-6	A, C	protein	501	Homo sapiens	Q15825 (AlphaFold model)
Neuronal acetylcholine receptor subunit beta-4,Soluble cytochrome b562	B, D, E	protein	633	Homo sapiens, Escherichia coli	P30926 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>8ZRN_1 Neuronal acetylcholine receptor subunit alpha-6 (chains A, C)
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLGSGSLEVLFQGPGGSGSGSLEVLFQGPGGSLQWVVENSEHSPELAD
ILNEVQYIANRFRSQNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGNT
GKSSASASASASAHHHHHHHH

Sequence of entity 2 (B, D, E), FASTA

>8ZRN_2 Neuronal acetylcholine receptor subunit beta-4,Soluble cytochrome b562 (chains B, D, E)
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
GSGSLEVLFQGPGGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATP
PKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKY
LGSGSLEVLFQGPGGSPAGSTPVAIPRDFWLRSSGRFRPDLAEILEEVSYIANRFRNQDE
DQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPYAAQRDSASAS
ASASAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
A1D8V	5-[[(2~{S})-azetidin-2-yl]methoxy]-2-chloranyl-pyridine	C9 H11 Cl N2 O	2

Primary citation

Molecular insights into the alpha 6 beta 4 nicotinic acetylcholine receptor function and ligand recognition. Su, J., Yu, Z., Yin, Z. et al. Nat Commun (2025) 16:3153-3153. DOI 10.1038/s41467-025-58333-0 · PubMed

Other PDB entries of the same protein (UniProt Q15825 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZRP 3.32 Å, Structure of nico

Browse structure collections

About this viewer

MolViewer shows 8ZRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.