8ZRP: Nico

Structure of nico. Determined by electron microscopy at 3.32 Å resolution. Released 30 Apr 2025.

Method: Electron microscopy
Resolution: 3.32 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 5
Atoms: 16,042
Mol. weight: 331.2 kDa
Ligands: NCT
Released: 30 Apr 2025

Explore 8ZRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZRP contains 54 α-helices and 103 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	33-43	11
β-strand	59-69	11	1
β-strand	73-74	2	1
β-strand	79-91	13	1
β-strand	109-110	2	2
α-helix	112-114	3
β-strand	120-122	3	3
β-strand	125	1	1
α-helix	137	1
β-strand	138-139	2	2
β-strand	145-148	4	1
β-strand	151-157	7	1
β-strand	169-178	10	3
β-strand	186-190	5	1
β-strand	194	1	4
β-strand	196	1	1
β-strand	201	1	1
β-strand	206-210	5	3
β-strand	212	1	4
β-strand	213-219	7	3
β-strand	226-238	13	3
α-helix	248-257	10
α-helix	258-262	5
α-helix	271-290	20
α-helix	302-328	27
α-helix	339-344	6
α-helix	349-352	4
α-helix	651-705	55

Chain B: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	27-34	8
β-strand	54	1	5
β-strand	57-69	13	6
β-strand	74-84	11	6
β-strand	86	1	7
β-strand	103	1	8
β-strand	106	1	9
β-strand	115-117	3	10
β-strand	120	1	6
β-strand	132	1	9
β-strand	134-135	2	8
β-strand	140	1	7
β-strand	141-142	2	8
β-strand	143	1	6
β-strand	146-152	7	6
β-strand	164-173	10	10
β-strand	181	1	5
β-strand	184-185	2	6
β-strand	189	1	11
β-strand	201-205	5	10
β-strand	207	1	11
β-strand	208-212	5	10
β-strand	220-230	11	10
α-helix	235-238	4
α-helix	241-248	8
α-helix	249-255	7
α-helix	263-282	20
α-helix	294-320	27
α-helix	333-336	4
α-helix	341-344	4
α-helix	521-573	53

Chain C: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	33-41	9
α-helix	58-60	3
β-strand	61-64	4	12
β-strand	66	1	13
β-strand	67-74	8	14
β-strand	79-85	7	14
β-strand	87-91	5	12
β-strand	107-108	2	15
α-helix	112-114	3
β-strand	120-122	3	16
β-strand	125	1	14
β-strand	140-141	2	15
β-strand	145-148	4	12
β-strand	151-157	7	14
β-strand	169	1	17
β-strand	172-178	7	16
β-strand	188-190	3	12
β-strand	194	1	18
β-strand	196	1	13
β-strand	206-208	3	17
β-strand	212	1	18
β-strand	213-218	6	16
β-strand	227-234	8	16
β-strand	236-238	3	17
α-helix	242-245	4
α-helix	249-256	8
α-helix	259-263	5
α-helix	273-290	18
α-helix	306-325	20
α-helix	339-345	7
α-helix	349-352	4
α-helix	652-705	54

Chain D: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	54	1	19
β-strand	57-58	2	20
β-strand	61-68	8	21
β-strand	74-80	7	21
β-strand	83	1	22
β-strand	84	1	20
β-strand	102-106	5	23
α-helix	107-109	3
β-strand	115-117	3	24
β-strand	120	1	21
β-strand	132-136	5	23
β-strand	142	1	23
β-strand	143	1	22
β-strand	146-152	7	21
α-helix	160-162	3
β-strand	164-173	10	24
β-strand	181	1	19
β-strand	184-185	2	20
β-strand	191	1	21
β-strand	201	1	25
β-strand	205	1	24
β-strand	208-212	5	24
β-strand	220-229	10	24
β-strand	230	1	25
α-helix	235-238	4
α-helix	240-247	8
α-helix	248-250	3
α-helix	252-255	4
α-helix	267-284	18
α-helix	294-320	27
α-helix	331-335	5
α-helix	336-340	5
α-helix	341-344	4
α-helix	520-574	55

Chain E: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	26-32	7
α-helix	33-37	5
β-strand	54	1	26
β-strand	57-67	11	27
β-strand	74-86	13	27
β-strand	102-103	2	27
β-strand	106	1	28
β-strand	115-117	3	29
β-strand	120	1	27
β-strand	132	1	28
β-strand	134-136	3	27
β-strand	140-143	4	27
β-strand	146-152	7	27
β-strand	164-173	10	29
β-strand	181	1	26
β-strand	184-185	2	27
β-strand	191	1	27
α-helix	196-198	3
β-strand	202-205	4	29
β-strand	208-212	5	29
β-strand	220-229	10	29
α-helix	234-237	4
α-helix	240-249	10
α-helix	252-255	4
α-helix	263-284	22
β-strand	288	1	30
β-strand	291	1	30
α-helix	294-320	27
α-helix	331-337	7
α-helix	341-344	4
α-helix	520-570	51

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal acetylcholine receptor subunit alpha-6	A, C	protein	501	Homo sapiens	Q15825 (AlphaFold model)
Neuronal acetylcholine receptor subunit beta-4,Soluble cytochrome b562	B, D, E	protein	633	Homo sapiens, Escherichia coli	P30926 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>8ZRP_1 Neuronal acetylcholine receptor subunit alpha-6 (chains A, C)
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLGSGSLEVLFQGPGGSGSGSLEVLFQGPGGSLQWVVENSEHSPELAD
ILNEVQYIANRFRSQNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGNT
GKSSASASASASAHHHHHHHH

Sequence of entity 2 (B, D, E), FASTA

>8ZRP_2 Neuronal acetylcholine receptor subunit beta-4,Soluble cytochrome b562 (chains B, D, E)
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
GSGSLEVLFQGPGGSADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATP
PKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKY
LGSGSLEVLFQGPGGSPAGSTPVAIPRDFWLRSSGRFRPDLAEILEEVSYIANRFRNQDE
DQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPYAAQRDSASAS
ASASAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NCT	(s)-3-(1-methylpyrrolidin-2-yl)pyridine	C10 H14 N2	2

Primary citation

Molecular insights into the alpha 6 beta 4 nicotinic acetylcholine receptor function and ligand recognition. Su, J., Yu, Z., Yin, Z. et al. Nat Commun (2025) 16:3153-3153. DOI 10.1038/s41467-025-58333-0 · PubMed

Other PDB entries of the same protein (UniProt Q15825 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZRN 3.25 Å, Structure of abt

Browse structure collections

About this viewer

MolViewer shows 8ZRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.