Crystal structure of Ssr1698 in complex with heme b. Determined by X-ray diffraction at 1.51 Å resolution. Released 25 Dec 2024.
Explore 8ZXQ in 3D Show helices and sheets RCSB PDB PDBe
8ZXQ contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-20 | 14 | |
| α-helix | 22-27 | 6 | |
| α-helix | 28-32 | 5 | |
| β-strand | 40-47 | 8 | 1 |
| β-strand | 50-57 | 8 | 1 |
| β-strand | 60-67 | 8 | 1 |
| α-helix | 75-93 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ssr1698 protein | A | protein | 105 | Synechocystis sp. (strain PCC 6803 / Kazusa) | P73129 (AlphaFold model) |
>8ZXQ_1 Ssr1698 protein (chains A) MMADPLTPAISDRICKHMNEDHASAIALYAQVFGQQTDVTMAQMQAIDPTGMDLVVESEG GSKTIRIEFEQPLKDSEDAHQVLIAMAKQARSVGKNSLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
Structural Basis for Monomer-Dimer Transition of Dri1 Upon Heme Binding. Wang, X.Y., Zhang, J., Li, H.Y. et al. Proteins (2025) 93:949-956. DOI 10.1002/prot.26778 · PubMed
Other PDB entries of the same protein (UniProt P73129 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ZXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.