9BJH: Neutralizing human monoclonal antibody 75C8

Crystal structure of neutralizing human monoclonal antibody 75C8 in complex with AMA1 DI-DII. Determined by X-ray diffraction at 2.8 Å resolution. Released 12 Mar 2025.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Plasmodium falciparum 3D7, Homo sapiens
Chains: 6
Atoms: 11,236
Mol. weight: 179 kDa
Released: 12 Mar 2025

Explore 9BJH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BJH contains 56 α-helices and 140 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	113-117	5
α-helix	119-122	4
β-strand	133-137	5	1
β-strand	140-144	5	1
β-strand	151-152	2	2
β-strand	154-158	5	3
β-strand	168	1	4
α-helix	169-170	2
β-strand	182	1	4
α-helix	183-185	3
β-strand	193-194	2	2
α-helix	195-201	7
α-helix	207-210	4
α-helix	213-222	10
α-helix	226-228	3
β-strand	238-241	4	2
β-strand	246-249	4	2
β-strand	250	1	4
β-strand	257	1	3
β-strand	276-280	5	3
β-strand	287-290	4	2
α-helix	298-301	4
β-strand	306	1	5
β-strand	307-308	2	6
β-strand	311-313	3	7
β-strand	314-316	3	8
β-strand	319-321	3	8
α-helix	322-323	2
β-strand	327-330	4	6
α-helix	334-344	11
β-strand	399-403	5	6
β-strand	408-412	5	6
β-strand	418-420	3	7
β-strand	425-429	5	6
β-strand	437	1	5

Chain B: 14 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	115-117	3
α-helix	119-122	4
β-strand	129	1	9
β-strand	133-137	5	10
β-strand	140-144	5	10
β-strand	151-152	2	11
β-strand	154-158	5	12
β-strand	168	1	13
α-helix	169-170	2
β-strand	182	1	13
α-helix	183-185	3
β-strand	193-194	2	11
α-helix	195-201	7
α-helix	207-209	3
α-helix	213-222	10
α-helix	226-228	3
β-strand	238-241	4	11
β-strand	246-249	4	11
β-strand	250	1	13
β-strand	257	1	12
β-strand	276-280	5	12
α-helix	282-284	3
β-strand	287-290	4	11
α-helix	298-301	4
β-strand	306	1	14
β-strand	307-308	2	15
β-strand	311-314	4	16
α-helix	316-318	3
β-strand	321-322	2	16
α-helix	323	1
β-strand	327-330	4	15
α-helix	334-344	11
β-strand	347	1	9
α-helix	388-390	3
β-strand	399-403	5	15
β-strand	408-412	5	15
β-strand	418-420	3	16
β-strand	425-429	5	15
β-strand	437	1	14

Chain H: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	17
β-strand	11-12	2	18
β-strand	18-25	8	17
β-strand	33-39	7	19
β-strand	41	1	20
β-strand	43	1	20
β-strand	45-52	8	19
β-strand	59	1	19
α-helix	61-63	3
β-strand	67-72	6	17
β-strand	77-82	6	17
α-helix	87-89	3
β-strand	91-98	8	19
α-helix	103-105	3
β-strand	108-111	4	19
β-strand	115-117	3	19
β-strand	118-119	2	18
α-helix	123-124	2
β-strand	125	1	21
β-strand	128-132	5	22
β-strand	139-140	2	22
β-strand	143-153	11	22
β-strand	154	1	21
β-strand	159-162	4	23
α-helix	163-165	3
β-strand	167	1	23
β-strand	171-173	3	22
α-helix	174-176	3
β-strand	177-178	2	22
β-strand	184-193	10	22
α-helix	194-196	3
β-strand	202-208	7	23
β-strand	213-219	7	23

Chain I: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	24
β-strand	11-12	2	25
β-strand	18-25	8	24
β-strand	33-40	8	26
β-strand	44-52	9	26
β-strand	57-59	3	26
β-strand	69-72	4	24
β-strand	77-82	6	24
α-helix	87-89	3
β-strand	91-98	8	26
α-helix	103-105	3
β-strand	108-111	4	26
β-strand	115-117	3	26
β-strand	118-119	2	25
α-helix	123-124	2
β-strand	125	1	27
β-strand	128-132	5	28
β-strand	143-153	11	28
β-strand	154	1	27
β-strand	159-162	4	29
α-helix	163-165	3
β-strand	167	1	29
β-strand	171-173	3	28
α-helix	174-176	3
β-strand	177-178	2	28
β-strand	184-193	10	28
α-helix	194-196	3
β-strand	203-208	6	29
α-helix	209-211	3
β-strand	213-218	6	29

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	30
β-strand	10-13	4	31
β-strand	19-25	7	30
α-helix	31-33	3
β-strand	34-39	6	31
β-strand	46-50	5	31
β-strand	54-55	2	31
α-helix	56	1
β-strand	63-68	6	30
β-strand	71-76	6	30
α-helix	81-83	3
β-strand	86-91	6	31
α-helix	97	1
β-strand	98-99	2	31
β-strand	103-107	5	31
β-strand	112	1	32
α-helix	113-114	2
β-strand	115-119	5	33
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	33
β-strand	141	1	32
β-strand	146-151	6	34
β-strand	154-155	2	34
β-strand	160-164	5	33
β-strand	174-183	10	33
α-helix	184-188	5
β-strand	192-198	7	34
β-strand	206-211	6	34

Chain M: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	35
β-strand	10-13	4	36
β-strand	19-23	5	35
α-helix	31-33	3
β-strand	34-39	6	36
β-strand	46-50	5	36
β-strand	54-55	2	36
α-helix	56	1
β-strand	63-68	6	35
β-strand	71-76	6	35
α-helix	81-83	3
β-strand	86-91	6	36
α-helix	97	1
β-strand	98-99	2	36
β-strand	103-107	5	36
β-strand	112	1	37
α-helix	113-114	2
β-strand	115-119	5	38
α-helix	120-122	3
α-helix	123-127	5
β-strand	130-140	11	38
β-strand	141	1	37
β-strand	145-151	7	39
β-strand	154-155	2	39
β-strand	160-164	5	38
α-helix	166-168	3
β-strand	174-183	10	38
α-helix	184-187	4
β-strand	192-199	8	39
β-strand	206-211	6	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apical membrane antigen 1	A, B	protein	347	Plasmodium falciparum 3D7	P22621 (AlphaFold model)
75C8 Fab Heavy Chain	H, I	protein	239	Homo sapiens
75C8 Fab Light Chain	L, M	protein	218	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>9BJH_1 Apical membrane antigen 1 (chains A, B)
ETGNYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIEN
SNTAFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRH
AGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAK
DISFQNYAYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKL
VFELSASDQPKQYEQHLTDYEKIKEGFKNKNAAMIKSAFLPTGAFKADRYKSHGKGYNWG
NYNTETQKCEIFNVKPTCLINNAAYIATTALSHPIEVEGTKHHHHHH

Sequence of entity 2 (H, I), FASTA

>9BJH_2 75C8 Fab Heavy Chain (chains H, I)
MGIQVQLRESGPHLVKPSETLSLTCNVSGGTINRYYWNWIRQIPGKGLEWIGNIYYTGTT
ETNPSLEGRPLISIDRTTQQVSLTLTSVTPADTAVYYCARTRGEWSPDWCLDRWGRGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGGSHHHHHH

Sequence of entity 3 (L, M), FASTA

>9BJH_3 75C8 Fab Light Chain (chains L, M)
MGIEIVLTQSPDTLSLSPGDTATLSCRASQTITNAYFAWYQQKPGQAPRLLIYSTSTRAS
GIPDRFSGSGSGTEFTLTISRLEPEDFAVFYCQQYVRSPWTFGQGTKVELKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

A strain-transcending anti-AMA1 human monoclonal antibody neutralizes malaria parasites independent of direct RON2L receptor blockade. Patel, P.N., Diouf, A., Dickey, T.H. et al. Cell Rep Med (2025) 6:101985-101985. DOI 10.1016/j.xcrm.2025.101985 · PubMed

Other PDB entries of the same protein (UniProt P22621 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q8B 2.3 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
2Q8A 2.4 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
9BJG 2.9 Å, Crystal structure of broadly neutralizing human monoclonal antibody 75B10 in complex…
1YXE Structure and inter-domain interactions of domain II from the blood stage malarial…

Browse structure collections

About this viewer

MolViewer shows 9BJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.