Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B. Determined by X-ray diffraction at 1.4 Å resolution. Released 28 Aug 2024.
Explore 9C66 in 3D Show helices and sheets RCSB PDB PDBe
9C66 contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| β-strand | 8-17 | 10 | 1 |
| β-strand | 22-25 | 4 | 1 |
| α-helix | 26-28 | 3 | |
| β-strand | 32-40 | 9 | 1 |
| α-helix | 41-43 | 3 | |
| β-strand | 45-52 | 8 | 1 |
| β-strand | 58-63 | 6 | 1 |
| α-helix | 64-65 | 2 | |
| β-strand | 71-72 | 2 | 1 |
| β-strand | 77-81 | 5 | 1 |
| β-strand | 86-91 | 6 | 1 |
| α-helix | 94-111 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 307-309 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein enabled homolog | A | protein | 114 | Homo sapiens | Q8N8S7 (AlphaFold model) |
| poly-proline segment of PTP1B | B | protein | 10 | Homo sapiens | P18031 (AlphaFold model) |
>9C66_1 Protein enabled homolog (chains A) SMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVV INCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNS
>9C66_2 poly-proline segment of PTP1B (chains B) EHIPPPPRPP
Insights into the Interaction Landscape of the EVH1 Domain of Mena. LaComb, L., Ghosh, A., Bonanno, J.B. et al. Biochemistry (2024) 63:2183-2195. DOI 10.1021/acs.biochem.4c00331 · PubMed
Other PDB entries of the same protein (UniProt Q8N8S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9C66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.