9C7D: Human monoclonal antibody MAD22-38

Human monoclonal antibody MAD22-38 bound to the N-terminus of cleaved circumsporozoite protein. Determined by X-ray diffraction at 1.99 Å resolution. Released 25 Dec 2024.

Method: X-ray diffraction
Resolution: 1.99 Å
Organisms: Homo sapiens, Plasmodium falciparum 3D7
Chains: 3
Atoms: 3,712
Mol. weight: 50.41 kDa
Released: 25 Dec 2024

Explore 9C7D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9C7D contains 19 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	35-39	7	2
β-strand	46-51	6	2
β-strand	57-59	3	2
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-98	11	2
β-strand	100C-103	7	2
β-strand	107-111	5	2
α-helix	115-116	2
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-124	5	4
α-helix	128-130	3
β-strand	131-132	2	4
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
α-helix	155-157	3
β-strand	159	1	5
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-170	2	4
β-strand	176-185	10	4
α-helix	186-188	3
β-strand	195-200	6	5
α-helix	201-203	3
β-strand	205-210	6	5

Chain L: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	2
β-strand	19-25	7	6
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
α-helix	59	1
β-strand	63-68	6	6
β-strand	71-76	6	6
α-helix	81-83	3
β-strand	85-91	7	2
α-helix	97	1
β-strand	98-99	2	2
β-strand	103-108	6	2
β-strand	112	1	7
α-helix	113-114	2
β-strand	115-119	5	8
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	8
β-strand	141	1	7
β-strand	146-151	6	9
β-strand	154-155	2	9
α-helix	156	1
β-strand	160-164	5	8
α-helix	165-168	4
β-strand	174-183	10	8
α-helix	184-188	5
β-strand	192-199	8	9
β-strand	202-209	8	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody MAD22-38 Fab Heavy Chain	H	protein	227	Homo sapiens
Monoclonal antibody MAD22-38 Fab Light Chain	L	protein	213	Homo sapiens
Circumsporozoite protein	B	protein	18	Plasmodium falciparum 3D7	Q7K740 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>9C7D_1 Monoclonal antibody MAD22-38 Fab Heavy Chain (chains H)
QLQLQESGPGLVKPAETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGSIYYTGSTY
YNPSLKSRVTISVDTSKNQFSLKLRSVTAADTAVYYCASIGWAVPGKRYYFDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 2 (L), FASTA

>9C7D_2 Monoclonal antibody MAD22-38 Fab Light Chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRANHSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
FRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYYTPWTFGPGTKVDIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTQGTTSVTKSFNRGEC

Sequence of entity 3 (B), FASTA

>9C7D_3 Circumsporozoite protein (chains B)
QPADGNPDPNANPNVDPN

Primary citation

Protective antibodies target cryptic epitope unmasked by cleavage of malaria sporozoite protein. Dacon, C., Moskovitz, R., Swearingen, K. et al. Science (2025) 387:eadr0510-eadr0510. DOI 10.1126/science.adr0510 · PubMed

Other PDB entries of the same protein (UniProt Q7K740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SG5 1.4 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var2
9C79 1.46 Å, Human monoclonal antibody MAD21-101 bound to the N-terminus of cleaved circumsporozoite…
9NKZ 1.48 Å, Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein
9NL0 1.54 Å, Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein
7SG6 1.55 Å, Structure of PfCSP peptide 21 with antibody CIS43_Var10
6PBV 1.57 Å, Crystal structure of Fab668 complex
9NCY 1.63 Å, Fab1392 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
3VDJ 1.7 Å, Crystal structure of circumsporozoite protein aTSR domain, R32 native form
9DST 1.74 Å, Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from…
9NI1 1.75 Å, Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum…
7RXP 1.76 Å, Fab1512 in complex with the C-terminal alpha-TSR domain of P. falciparum
6BQB 1.77 Å, MGG4 Fab in complex with peptide

Browse structure collections

About this viewer

MolViewer shows 9C7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.