9CCF: DA7-2

Crystal Structure of DA7-2. Determined by X-ray diffraction at 4.0 Å resolution. Released 13 Aug 2025.

Method: X-ray diffraction
Resolution: 4.0 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,221
Mol. weight: 56.36 kDa
Released: 13 Aug 2025

Explore 9CCF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CCF contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	1006-1025	20
α-helix	1029-1051	23
α-helix	1055-1076	22
α-helix	1080-1095	16
α-helix	1101-1122	22
α-helix	1131-1139	9
α-helix	1141-1143	3
α-helix	1146-1162	17
α-helix	1171-1179	9
α-helix	1184-1197	14

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1008-1025	18
α-helix	1029-1051	23
α-helix	1055-1076	22
α-helix	1080-1094	15
α-helix	1101-1122	22
α-helix	1129-1139	11
α-helix	1146-1163	18
α-helix	1169-1179	11
α-helix	1184-1195	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DA7_2	A, B	protein	241	Homo sapiens, synthetic construct	P01213 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9CCF_1 DA7_2 (chains A, B)
MYGGFLRRIRPKLKWDNQGSGSHHWGSKEEEIEKEFEEKKKIIEENLKEAEEEGEEEAAE
KLKEALKKLEEAIKLHREGANPVEVELEEVTAIILNNLAVLLREGEEELAKELEKAIKLL
EEKKDAPEEERLKAIAIAIIRSVLVLIKWEGGKDEETIEEIEEILENRENLSLEELREAY
VRAEIAYLIESGIDPEAAKKVREKYERGAPLEELLKDIEKIEKEAKKREEEKKLEHHHHH
H

Primary citation

Design of intrinsically disordered region binding proteins. Wu, K., Jiang, H., Hicks, D.R. et al. Science (2025) 389:eadr8063-eadr8063. DOI 10.1126/science.adr8063 · PubMed

Other PDB entries of the same protein (UniProt P01213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJU 1.99 Å, Structure of Human Neurolysin in complex with dynorphin A13 peptide
8VJV 2.12 Å, Structure of Human Neurolysin in complex with dynorphin A8(1-8) peptide
9L60 2.9 Å, Gi-bound kappa opioid receptor in complex with dynorphin and positive allosteric…
9CCE 3.15 Å, structure of DYNA_1b7
8F7W 3.19 Å, Gi bound kappa-opioid receptor in complex with dynorphin
7Y1F 3.3 Å, Cryo-EM structure of human k-opioid receptor-Gi complex
2N2F Solution NMR structure of Dynorphin 1-13 bound to Kappa Opioid Receptor

Browse structure collections

About this viewer

MolViewer shows 9CCF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.