9CK3: In-vitro alpha-synuclein fibril

Cryo-EM structure of in-vitro alpha-synuclein fibril. Determined by electron microscopy at 2.04 Å resolution. Released 24 Jul 2024.

Method: Electron microscopy
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 12
Atoms: 5,748
Mol. weight: 173.71 kDa
Released: 24 Jul 2024

Explore 9CK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CK3 contains 0 α-helices and 72 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K and L: 0 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	16-21	6	1
β-strand	37-57	21	2
β-strand	60-66	7	3
β-strand	69-82	14	4
β-strand	86-92	7	5
β-strand	95-96	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-synuclein	A, B, C, D, E, F, G, H, I, J, K, L	protein	140	Homo sapiens	P37840 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>9CK3_1 Alpha-synuclein (chains A, B, C, D, E, F, G, H, I, J, K, L)
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

Primary citation

High-resolution Cryo-EM Structure Determination of a-Synuclein-A Prototypical Amyloid Fibril. Sanchez, J.C., Pierson, J.A., Borcik, C.G. et al. Bio Protoc (2025) 15:e5171-e5171. DOI 10.21769/BioProtoc.5171 · PubMed

Other PDB entries of the same protein (UniProt P37840 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JJV 1.23 Å, Structure of truncated form of nanobody in complex with alpha-synuclein peptide
8JLY 1.29 Å, Structure of nanobody in complex with alpha-synuclein peptide
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
4R0U 1.38 Å, Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78
6I42 1.38 Å, Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex
4ZNN 1.41 Å, MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of…
4RIL 1.43 Å, Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of…
4R0W 1.5 Å, Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76
3Q26 1.54 Å, Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP)
3Q28 1.6 Å, Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP)
5CRW 1.6 Å, Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed…
2X6M 1.62 Å, Structure of a single domain camelid antibody fragment in complex with a C-terminal…

Browse structure collections

About this viewer

MolViewer shows 9CK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.