9CLJ: Capsid protein p24

HIV-2 CA T=1 Icosahedron; assembled via lipid templating. Determined by electron microscopy at 1.98 Å resolution. Released 5 Mar 2025.

Method: Electron microscopy
Resolution: 1.98 Å
Organism: Human immunodeficiency virus 2
Chains: 1
Atoms: 1,956
Mol. weight: 28.13 kDa
Ligands: IHP
Released: 5 Mar 2025

Explore 9CLJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CLJ contains 15 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-12	3	1
α-helix	17-29	13
α-helix	36-43	8
α-helix	49-58	10
α-helix	63-83	21
α-helix	90-91	2
α-helix	95-98	4
α-helix	100-104	5
α-helix	110-117	8
α-helix	126-145	20
α-helix	161-174	14
α-helix	179-184	6
α-helix	185-189	5
α-helix	190-192	3
α-helix	196-205	10
α-helix	211-218	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein p24	A	protein	240	Human immunodeficiency virus 2	P18042

Sequence of entity 1 (A), FASTA

>9CLJ_1 Capsid protein p24 (chains A)
PVQQTGGGNYIHVPLSPRTLNAWVKLVEDKKFGAEVVPGFQALSEGCTPYDINQMLNCVG
DHQAAMQIIREIINDEAADWDAQHPIPGPLPAGQLRDPRGSDIAGTTSTVEEQIQWMYRP
QNPVPVGNIYRRWIQIGLQKCVRMYNPTNILDVKQGPKEPFQSYVDRFYKSLRAEQTDPA
VKNWMTQTLLIQNANPDCKLVLKGLGMNPTLEEMLTACQGVGGPGQKARLMGSSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	2

Primary citation

Structural insights into HIV-2 CA lattice formation and FG-pocket binding revealed by single-particle cryo-EM. Cook, M., Freniere, C., Wu, C. et al. Cell Rep (2025) 44:115245-115245. DOI 10.1016/j.celrep.2025.115245 · PubMed

Other PDB entries of the same protein (UniProt P18042), best resolution first:

9CNT 2.97 Å, HIV-2 CA pentamer; assembled via liposome templating
9CNU 2.99 Å, HIV-2 CA hexamer bound with Nup153 peptide; assembled with liposome templating
9CNV 3.16 Å, HIV-2 CA hexamer bound with CPSF6 peptide; assembled via liposome templating
9CNS 3.25 Å, HIV-2 CA hexamer; assembled via liposome templating
2E1X NMR structure of the HIV-2 nucleocapsid protein
2IWJ Solution structure of the ZN complex of HIV-2 NCP(23-49) peptide, encompassing protein…

Browse structure collections

About this viewer

MolViewer shows 9CLJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.