HIV-2 CA hexamer; assembled via liposome templating. Determined by electron microscopy at 3.25 Å resolution. Released 5 Mar 2025.
Explore 9CNS in 3D Show helices and sheets RCSB PDB PDBe
9CNS contains 26 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 11-12 | 2 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 17-27 | 11 | |
| α-helix | 36-43 | 8 | |
| α-helix | 49-58 | 10 | |
| α-helix | 63-83 | 21 | |
| α-helix | 90-91 | 2 | |
| α-helix | 95-98 | 4 | |
| α-helix | 100-104 | 5 | |
| α-helix | 110-118 | 9 | |
| α-helix | 128-144 | 17 | |
| α-helix | 150-152 | 3 | |
| α-helix | 161-174 | 14 | |
| α-helix | 179-192 | 14 | |
| α-helix | 196-204 | 9 | |
| α-helix | 211-217 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 161-166 | 6 | |
| α-helix | 169-174 | 6 | |
| α-helix | 179-184 | 6 | |
| α-helix | 185-189 | 5 | |
| α-helix | 190-192 | 3 | |
| α-helix | 196-205 | 10 | |
| α-helix | 211-217 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 165-175 | 11 | |
| α-helix | 179-192 | 14 | |
| α-helix | 196-205 | 10 | |
| α-helix | 211-217 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Capsid protein p24 | A, B, C | protein | 240 | Human immunodeficiency virus 2 | P18042 |
>9CNS_1 Capsid protein p24 (chains A, B, C) PVQQTGGGNYIHVPLSPRTLNAWVKLVEDKKFGAEVVPGFQALSEGCTPYDINQMLNCVG DHQAAMQIIREIINDEAADWDAQHPIPGPLPAGQLRDPRGSDIAGTTSTVEEQIQWMYRP QNPVPVGNIYRRWIQIGLQKCVRMYNPTNILDVKQGPKEPFQSYVDRFYKSLRAEQTDPA VKNWMTQTLLIQNANPDCKLVLKGLGMNPTLEEMLTACQGVGGPGQKARLMGSSHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| IHP | Inositol hexakisphosphate | C6 H18 O24 P6 | 2 |
Structural insights into HIV-2 CA lattice formation and FG-pocket binding revealed by single-particle cryo-EM. Cook, M., Freniere, C., Wu, C. et al. Cell Rep (2025) 44:115245-115245. DOI 10.1016/j.celrep.2025.115245 · PubMed
Other PDB entries of the same protein (UniProt P18042), best resolution first:
MolViewer shows 9CNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.