9CSB: Gamma-aminobutyric acid receptor subunit beta-3

Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly. Determined by electron microscopy at 3.34 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.34 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 15,525
Mol. weight: 334.48 kDa
Ligands: POV, NAG, PIO
Released: 22 Jan 2025

Explore 9CSB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CSB contains 59 α-helices and 118 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	35	1
β-strand	36-41	6	1
β-strand	42-43	2	2
β-strand	46-51	6	3
β-strand	56-61	6	3
β-strand	64-68	5	1
β-strand	81	1	1
α-helix	85-89	5
β-strand	96-98	3	4
β-strand	101-106	6	3
β-strand	114-118	5	1
β-strand	123-128	6	1
β-strand	130-135	6	3
β-strand	147-156	10	4
β-strand	164-168	5	1
α-helix	171-173	3
β-strand	175-176	2	2
β-strand	186-200	15	4
β-strand	203-216	14	4
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-241	4
α-helix	247-268	22
α-helix	280-306	27
α-helix	421-446	26

Chain B: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
β-strand	39-54	16	5
β-strand	59-70	12	5
β-strand	71	1	6
β-strand	84-86	3	7
α-helix	89-92	4
β-strand	99-101	3	8
β-strand	104	1	5
β-strand	108-109	2	5
β-strand	113	1	4
β-strand	117	1	5
β-strand	119-121	3	7
β-strand	126	1	6
β-strand	129-138	10	5
α-helix	143-145	3
β-strand	152-153	2	8
β-strand	156-159	4	8
β-strand	167-171	5	5
α-helix	175-177	3
β-strand	179-181	3	5
β-strand	186	1	5
β-strand	191-204	14	8
β-strand	209-221	13	8
α-helix	226-229	4
α-helix	231-242	12
α-helix	243-246	4
α-helix	252-276	25
α-helix	285-309	25
α-helix	391-416	26

Chain C: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	35	1
β-strand	36-47	12	9
β-strand	51	1	9
β-strand	56-68	13	9
α-helix	70-72	3
β-strand	81-83	3	9
α-helix	87-89	3
β-strand	96-98	3	10
β-strand	101-106	6	9
β-strand	114-118	5	9
β-strand	123-135	13	9
β-strand	147	1	10
β-strand	151-156	6	10
β-strand	164-168	5	9
α-helix	171-173	3
β-strand	176	1	9
β-strand	186-200	15	10
β-strand	203-216	14	10
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-240	3
α-helix	247-267	21
α-helix	280-307	28
α-helix	462-486	25

Chain D: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
β-strand	40-42	3	11
β-strand	43-44	2	12
β-strand	49	1	13
β-strand	52-53	2	14
β-strand	58-59	2	14
β-strand	64-70	7	12
α-helix	72-74	3
β-strand	83-85	3	12
α-helix	89-91	3
β-strand	99-100	2	15
β-strand	103	1	16
β-strand	108	1	17
β-strand	110	1	18
β-strand	114	1	18
β-strand	116-120	5	12
β-strand	125-131	7	12
β-strand	132	1	17
β-strand	136	1	16
β-strand	137	1	14
β-strand	151-152	2	15
β-strand	156-157	2	15
β-strand	168-170	3	11
β-strand	178	1	12
β-strand	185	1	13
β-strand	192-204	13	15
β-strand	207-218	12	15
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	241-245	5
α-helix	251-274	24
α-helix	286-309	24
α-helix	388-411	24

Chain E: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	43	1
α-helix	50	1
β-strand	51-66	16	19
β-strand	71-83	13	19
β-strand	95-98	4	19
α-helix	100-105	6
β-strand	111-113	3	20
β-strand	116-121	6	19
β-strand	129-134	6	19
β-strand	138-150	13	19
β-strand	162-165	4	21
β-strand	168-171	4	20
β-strand	179-189	11	19
β-strand	201-208	8	21
β-strand	211-214	4	22
β-strand	219-222	4	22
β-strand	223-224	2	20
β-strand	225-231	7	21
α-helix	236	1
α-helix	237-241	5
α-helix	242-251	10
α-helix	252-256	5
α-helix	262-285	24
α-helix	295-321	27
α-helix	410-433	24

Chain I: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	23
β-strand	7	1	24
β-strand	10-12	3	25
β-strand	18-20	3	26
β-strand	22	1	24
β-strand	23-24	2	27
β-strand	25	1	23
β-strand	33-38	6	28
β-strand	45-49	5	28
β-strand	53-54	2	28
α-helix	55	1
β-strand	62-65	4	26
β-strand	70-71	2	27
β-strand	72-76	5	26
α-helix	80-82	3
β-strand	85-90	6	28
β-strand	96-97	2	28
β-strand	101	1	28
β-strand	102-104	3	25

Chain J: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	29
β-strand	10-12	3	30
β-strand	18-25	8	29
β-strand	34-39	6	31
β-strand	45-52	8	31
β-strand	57-60	4	31
α-helix	62-64	3
β-strand	65	1	29
β-strand	68-73	6	29
β-strand	78-83	6	29
α-helix	88-90	3
β-strand	93-98	6	31
β-strand	108	1	31
β-strand	112-113	2	31
β-strand	114-116	3	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-3	A	protein	448	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	C	protein	488	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-2	D	protein	423	Homo sapiens	P47869 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	436	Homo sapiens	P18507
Kappa Fab_1F4 Light Chain	I	protein	213	Mus musculus
IgG2b Fab_1F4 Heavy Chain	J	protein	454	Mus musculus

Sequence of entity 1 (A), FASTA

>9CSB_1 Gamma-aminobutyric acid receptor subunit beta-3 (chains A)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI
GDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDV
NAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 2 (B), FASTA

>9CSB_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (C), FASTA

>9CSB_3 Gamma-aminobutyric acid receptor subunit beta-2 (chains C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN

Sequence of entity 4 (D), FASTA

>9CSB_4 Gamma-aminobutyric acid receptor subunit alpha-2 (chains D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP

Sequence of entity 5 (E), FASTA

>9CSB_5 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 6 (I), FASTA

>9CSB_6 Kappa Fab_1F4 Light Chain (chains I)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 7 (J), FASTA

>9CSB_7 IgG2b Fab_1F4 Heavy Chain (chains J)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P28472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A5V 1.7 Å, CryoEM structure of a human gamma-aminobutyric acid receptor, the GABA(A)R-beta3…
9RGD 2.0 Å, CryoEM structure of human alpha1beta3gamma2L GABA(A)R in CL47a
9EQG 2.4 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA…
6QFA 2.49 Å, CryoEM structure of a beta3K279T GABA(A)R homomer in complex with histamine and megabody…
7QN5 2.5 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
9FAS 2.5 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
9FEU 2.5 Å, Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the…
9FFU 2.5 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
9G2E 2.5 Å, Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived desensitised…
9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
8PET 2.6 Å, Cryo-EM structure of the full-length human alpha1beta3 GABA(A) receptor (babba…
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…

Browse structure collections

About this viewer

MolViewer shows 9CSB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.