Streptavidin-E101Q-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor. Determined by X-ray diffraction at 1.13 Å resolution. Released 11 Dec 2024.
Explore 9CST in 3D Show helices and sheets RCSB PDB PDBe
9CST contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-17 | 4 | |
| β-strand | 19-23 | 5 | 1 |
| β-strand | 28-33 | 6 | 1 |
| β-strand | 38-44 | 7 | 1 |
| β-strand | 54-60 | 7 | 1 |
| β-strand | 71-80 | 10 | 1 |
| β-strand | 85-97 | 13 | 1 |
| β-strand | 103-112 | 10 | 1 |
| α-helix | 113 | 1 | |
| α-helix | 116-121 | 6 | |
| β-strand | 123-131 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Streptavidin | A | protein | 159 | Streptomyces avidinii | P22629 (AlphaFold model) |
>9CST_1 Streptavidin (chains A) MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRY DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTSGTTEANAW ASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| QG7 | N-(2-{bis[(pyridin-2-yl)methyl]amino}ethyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-t… | C24 H32 N6 O2 S | 1 |
| CU | Copper (II) ion | Cu | 4 |
Selective oxidation of active site aromatic residues in engineered Cu proteins. Uyeda, K.S., Follmer, A.H., Borovik, A.S. Chem Sci (2024) 16:98-103. DOI 10.1039/d4sc06667g · PubMed
Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9CST directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.