9CWN: Peroxisome proliferator-activated receptor gamma

NRIP1_133 / RIP140 SxxLxxLL motif coregulator peptide with agonist GW1929 and PPARg LBD. Determined by X-ray diffraction at 2.7 Å resolution. Released 14 Aug 2024.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,301
Mol. weight: 34.53 kDa
Ligands: EDK
Released: 14 Aug 2024

Explore 9CWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CWN contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	239-253	15
α-helix	258-265	8
α-helix	272-274	3
β-strand	275-277	3	1
α-helix	280-286	7
α-helix	287-289	3
α-helix	305-328	24
α-helix	339-360	22
β-strand	362-363	2	1
β-strand	366-369	4	1
β-strand	374-377	4	1
α-helix	378-382	5
α-helix	388-390	3
α-helix	393-403	11
α-helix	409-420	12
α-helix	431-452	22
α-helix	459-487	29
α-helix	492-494	3
α-helix	495-501	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-137	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxisome proliferator-activated receptor gamma	A	protein	276	Homo sapiens	P37231 (AlphaFold model)
Nuclear receptor-interacting protein 1	B	protein	23	Homo sapiens	P48552 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CWN_1 Peroxisome proliferator-activated receptor gamma (chains A)
GQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDK
IKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYG
VHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDD
SDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTD
LRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Sequence of entity 2 (B), FASTA

>9CWN_2 Nuclear receptor-interacting protein 1 (chains B)
DSVRKGKQDSTLLASLLQSFSSR

Ligands and cofactors

ID	Name	Formula	Copies
EDK	(2~{S})-3-[4-[2-[methyl(pyridin-2-yl)amino]ethoxy]phenyl]-2-[[2-(phenylcarbonyl…	C30 H29 N3 O4	1

Primary citation

NRIP1_133 / RIP140 SxxLxxLL motif coregulator peptide with agonist GW1929 and PPARg LBD. Nemetchek, M.D., Voss, A.H., Hughes, T.S. To be published.

Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F7W 1.25 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…
8BF1 1.36 Å, High-resolution structure of unliganded PPAR gamma in complex with the peptide PGC-1 alpha
9V8G 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL
9V8H 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL and rosiglitazone
8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
6MS7 1.43 Å, Peroxisome proliferator-activated receptor gamma ligand binding domain in complex with a…
9V8D 1.44 Å, PPARgamma ligand-binding domain in complex with PG08
3U9Q 1.52 Å, Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide
8B94 1.55 Å, Crystal structure of PPARG and NCOR2 with BAY-5516, an inverse agonist
8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
3B1M 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
3V9V 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…

Browse structure collections

About this viewer

MolViewer shows 9CWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.