9CY8: Ephrin type-A receptor 4

Constrained b-hairpins targeting the EphA4 ligand binding domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 25 Dec 2024.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,557
Mol. weight: 22.81 kDa
Released: 25 Dec 2024

Explore 9CY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CY8 contains 2 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	1
α-helix	39-41	3
β-strand	46-48	3	2
β-strand	55-58	4	1
β-strand	68-73	6	1
β-strand	82-85	4	2
β-strand	89-90	2	2
β-strand	97-105	9	1
α-helix	108-110	3
β-strand	121-129	9	2
β-strand	143-149	7	2
β-strand	154-156	3	1
β-strand	165-173	9	1
β-strand	180-187	8	2
β-strand	191-202	12	1

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	3
β-strand	20-21	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-A receptor 4	A	protein	185	Homo sapiens	P54764 (AlphaFold model)
Constrained b-hairpin	B	protein	13	synthetic construct

Sequence of entity 1 (A), FASTA

>9CY8_1 Ephrin type-A receptor 4 (chains A)
GSHMNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWL
RTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVK
IDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
PLTVR

Sequence of entity 2 (B), FASTA

>9CY8_2 Constrained b-hairpin (chains B)
XPYLVYRXEWSPX

Primary citation

Constrained beta-Hairpins Targeting the EphA4 Ligand Binding Domain. Prentiss, A.M., Baggio, C., Pagett, J. et al. J Med Chem (2024) 67:22245-22253. DOI 10.1021/acs.jmedchem.4c02286 · PubMed

Other PDB entries of the same protein (UniProt P54764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OFV 1.43 Å, NMR-guided design of potent and selective EphA4 agonistic ligands
5JR2 1.75 Å, Crystal structure of the EphA4 LBD in complex with APYd3 peptide inhibitor
2WO1 1.85 Å, Crystal Structure of the EphA4 Ligand Binding Domain
4M4P 2.08 Å, Crystal structure of EPHA4 ectodomain
2WO3 2.35 Å, Crystal Structure of the EphA4-ephrinA2 complex
4W4Z 2.41 Å, Structure of the EphA4 LBD in complex with peptide
4W50 2.42 Å, Structure of the EphA4 LBD in complex with peptide
2WO2 2.45 Å, Crystal Structure of the EphA4-ephrinB2 complex
3GXU 2.5 Å, Crystal structure of Eph receptor and ephrin complex
3CKH 2.8 Å, Crystal structure of Eph A4 receptor
4M4R 3.13 Å, Epha4 ectodomain complex with ephrin a5
4BK4 3.65 Å, crystal structure of the human EphA4 ectodomain

Browse structure collections

About this viewer

MolViewer shows 9CY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.