9D34: FIP200 C-terminal CLAW domain

FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1 FIP200 interacting peptide. Determined by X-ray diffraction at 1.42 Å resolution. Released 6 Nov 2024.

Method: X-ray diffraction
Resolution: 1.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 802
Mol. weight: 13.53 kDa
Released: 6 Nov 2024

Explore 9D34 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9D34 contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1506-1512	7	1
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1532-1534	3
β-strand	1554-1567	14	1
β-strand	1581-1589	9	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	125-127	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RB1-inducible coiled-coil protein 1	A	protein	105	Homo sapiens	Q8TDY2 (AlphaFold model)
TNFAIP3-interacting protein 1	C	protein	13	Homo sapiens	Q15025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9D34_1 RB1-inducible coiled-coil protein 1 (chains A)
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGA
SRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Sequence of entity 2 (C), FASTA

>9D34_2 TNFAIP3-interacting protein 1 (chains C)
GTSSEFEVVTPEE

Primary citation

FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1 FIP200 interacting peptide. Radford, K.M., Rosencrans, W., Chou, T.F. To be published.

Other PDB entries of the same protein (UniProt Q8TDY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D0E 1.4 Å, Crystal structure of FIP200 Claw/p-CCPG1 FIR2
8YFL 1.5 Å, crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123
8YFM 1.5 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS122
6DCE 1.56 Å, X-ray structure of FIP200 claw domain
9J54 1.61 Å, Crystal structure of FIP200 Claw in complex with ATG16L1
7CZG 1.8 Å, Crystal structure of FIP200 Claw domain apo form
9LUA 1.97 Å, Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
8YFK 2.0 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS123
7EA2 2.14 Å, crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain
8YFN 2.3 Å, Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an…
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 9D34 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.