9DB5: Transcription factor ETV6,DARPin

A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker. Determined by X-ray diffraction at 1.57 Å resolution. Released 9 Oct 2024.

Method: X-ray diffraction
Resolution: 1.57 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 2,013
Mol. weight: 26.78 kDa
Released: 9 Oct 2024

Explore 9DB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DB5 contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	4-6	3
α-helix	7-10	4
α-helix	13-15	3
α-helix	18-32	15
α-helix	34	1
α-helix	36-38	3
α-helix	46-49	4
α-helix	54-60	7
α-helix	65-75	11
α-helix	80-90	11
α-helix	93-101	9
α-helix	116-123	8
α-helix	126-134	9
α-helix	149-156	8
α-helix	159-167	9
α-helix	182-188	7
α-helix	192-200	9
α-helix	215-221	7
α-helix	225-233	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,DARPin	A	protein	235	Homo sapiens, synthetic construct	P41212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9DB5_1 Transcription factor ETV6,DARPin (chains A)
GSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILPADLGKKLLEAARAGQDDEVRILMANGADVNATDNDGYTPLHLA
ASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADVNAYDNDGH
TPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN

Primary citation

Optimal 1TEL-target protein linker character is target protein-dependent. Pedroza Romo, M.J., Keliiliki, A., Averett, J.C. et al. Acta Crystallogr D Struct Biol (2026) 82:516-532. DOI 10.1107/S2059798326002494 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM
8THA 1.68 Å, 1TEL, non-compressed, double-helical crystal form

Browse structure collections

About this viewer

MolViewer shows 9DB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.