9DGR: Alpha-centractin

Composite structure of dynein-dynactin on microtubules. Determined by electron microscopy at 15.0 Å resolution. Released 10 Sept 2025.

Method: Electron microscopy
Resolution: 15.0 Å
Organism: Sus scrofa
Chains: 39
Atoms: 131,638
Mol. weight: 3758.42 kDa
Ligands: ZN, MG
Released: 10 Sept 2025

Explore 9DGR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DGR contains 1,315 α-helices and 904 β-strands across 39 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-16	5	1
β-strand	20-25	6	1
β-strand	33-36	4	1
β-strand	39-42	4	2
β-strand	45-46	2	3
α-helix	51-53	3
β-strand	57	1	2
α-helix	60-64	5
β-strand	69-72	4	2
β-strand	75-76	2	4
β-strand	79-80	2	4
α-helix	83-94	12
β-strand	108-112	5	1
α-helix	113	1
α-helix	118-130	13
β-strand	136-141	6	1
α-helix	142-150	9
β-strand	155-160	6	5
β-strand	165-171	7	5
β-strand	174-175	2	5
α-helix	177-179	3
β-strand	181-183	3	5
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	6
α-helix	228-233	6
α-helix	235-237	3
β-strand	240-242	3	7
β-strand	248-250	3	7
α-helix	254-257	4
α-helix	258-261	4
α-helix	265-267	3
α-helix	275-285	11
α-helix	288-296	9
β-strand	298-301	4	5
α-helix	303-306	4
β-strand	308	1	6
α-helix	310-321	12
α-helix	323	1
β-strand	330-331	2	5
α-helix	339-349	11
α-helix	352-356	5
β-strand	358-359	2	1
α-helix	360-366	7
α-helix	368-374	7

Chain B: 21 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	17
β-strand	20-25	6	17
β-strand	33-36	4	17
β-strand	39-42	4	18
β-strand	45-46	2	19
β-strand	57	1	18
α-helix	60-64	5
β-strand	69-72	4	18
β-strand	75-76	2	20
β-strand	79-80	2	20
α-helix	83-93	11
α-helix	103-105	3
β-strand	108-111	4	17
α-helix	118-130	13
β-strand	136-140	5	17
α-helix	143-150	8
β-strand	155-160	6	21
β-strand	165-171	7	21
β-strand	174-175	2	21
β-strand	181-183	3	21
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	22
α-helix	228-233	6
α-helix	235-236	2
β-strand	240-242	3	23
β-strand	248-250	3	23
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-267	3
α-helix	275-285	11
α-helix	288-296	9
β-strand	298-301	4	21
α-helix	303-306	4
β-strand	308	1	22
α-helix	310-321	12
α-helix	323	1
β-strand	328-331	4	21
α-helix	339-349	11
α-helix	353-356	4
β-strand	358-359	2	17
α-helix	360-366	7
α-helix	368-373	6

Chain C: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-15	4	28
β-strand	20-25	6	28
β-strand	33-36	4	28
β-strand	39-42	4	29
β-strand	45-46	2	30
β-strand	57	1	29
α-helix	60-64	5
β-strand	69-72	4	29
β-strand	75-76	2	31
β-strand	79-80	2	31
α-helix	83-93	11
α-helix	103-105	3
β-strand	108-111	4	28
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-140	5	28
α-helix	142-150	9
β-strand	155-160	6	3
β-strand	165-171	7	3
β-strand	174-175	2	3
β-strand	181-183	3	3
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	32
α-helix	228-233	6
β-strand	240-242	3	33
β-strand	248-250	3	33
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-267	3
α-helix	275-285	11
α-helix	291-296	6
β-strand	298-301	4	3
α-helix	303-306	4
β-strand	308	1	32
α-helix	310-321	12
α-helix	323	1
β-strand	330-333	4	3
α-helix	339-349	11
α-helix	352-356	5
β-strand	358-359	2	28
α-helix	360-366	7
α-helix	368-372	5

Chain D: 21 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	42
β-strand	20-25	6	42
β-strand	33-36	4	42
β-strand	39-42	4	43
β-strand	45-46	2	44
β-strand	57	1	43
α-helix	60-64	5
β-strand	69-72	4	43
β-strand	75-76	2	45
β-strand	79-80	2	45
α-helix	83-93	11
α-helix	103-105	3
β-strand	108-112	5	42
α-helix	118-130	13
β-strand	136-141	6	42
α-helix	142-150	9
β-strand	155-160	6	19
β-strand	165-171	7	19
β-strand	174-175	2	19
α-helix	177-179	3
β-strand	181-183	3	19
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	46
α-helix	228-234	7
β-strand	240-242	3	47
β-strand	248-250	3	47
α-helix	254-257	4
α-helix	259-263	5
α-helix	265-267	3
α-helix	275-285	11
α-helix	291-296	6
β-strand	298-301	4	19
α-helix	303-306	4
β-strand	308	1	46
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	19
α-helix	339-349	11
α-helix	352-356	5
β-strand	358-359	2	42
α-helix	360-366	7
α-helix	368-373	6

Chain e: 206 helices, 89 β-strands

Element	Residues	Length	Sheet
α-helix	29-42	14
α-helix	50-56	7
α-helix	59-70	12
α-helix	72-74	3
β-strand	77-81	5	199
β-strand	83-86	4	200
α-helix	87-88	2
α-helix	94-95	2
β-strand	96-99	4	200
β-strand	102-104	3	199
β-strand	114-118	5	199
α-helix	131-134	4
β-strand	138	1	199
α-helix	145-151	7
α-helix	152-157	6
α-helix	158-166	9
α-helix	178-198	21
α-helix	202-205	4
α-helix	213-222	10
α-helix	233-235	3
α-helix	239-261	23
α-helix	271-293	23
α-helix	295-306	12
α-helix	310-320	11
α-helix	322-337	16
α-helix	341-346	6
α-helix	350-366	17
α-helix	374-399	26
α-helix	401-404	4
α-helix	406-435	30
α-helix	455-482	28
α-helix	514-530	17
α-helix	540-572	33
α-helix	578-587	10
α-helix	595-622	28
α-helix	632-638	7
α-helix	643-669	27
α-helix	677-693	17
α-helix	696-709	14
β-strand	719-720	2	201
β-strand	724-725	2	202
β-strand	728-731	4	202
β-strand	735-736	2	201
α-helix	741-756	16
α-helix	762-797	36
α-helix	799-801	3
α-helix	806-818	13
α-helix	819-822	4
α-helix	829-866	38
α-helix	871-890	20
α-helix	896-928	33
α-helix	955-957	3
β-strand	961	1	203
β-strand	964-965	2	204
β-strand	968-969	2	204
α-helix	975-994	20
α-helix	996-998	3
α-helix	1014-1017	4
α-helix	1022-1025	4
α-helix	1029-1055	27
α-helix	1056-1058	3
α-helix	1059-1062	4
α-helix	1065-1072	8
α-helix	1076-1091	16
β-strand	1099-1102	4	203
β-strand	1105-1108	4	203
α-helix	1110-1154	45
α-helix	1163-1178	16
α-helix	1180-1201	22
α-helix	1211-1234	24
α-helix	1236-1263	28
α-helix	1273-1303	31
α-helix	1314-1348	35
α-helix	1351-1353	3
α-helix	1356-1371	16
α-helix	1375-1379	5
α-helix	1381-1403	23
α-helix	1410-1419	10
α-helix	1431-1436	6
α-helix	1443-1471	29
β-strand	1477-1480	4	205
β-strand	1484-1487	4	205
α-helix	1490-1509	20
α-helix	1511-1514	4
α-helix	1517-1548	32
α-helix	1557-1560	4
α-helix	1563-1583	21
α-helix	1588-1592	5
α-helix	1597-1625	29
α-helix	1627-1631	5
α-helix	1634-1642	9
α-helix	1647-1657	11
β-strand	1663	1	206
β-strand	1666	1	206
β-strand	1672-1677	6	206
β-strand	1683-1691	9	206
α-helix	1698-1728	31
α-helix	1735-1744	10
α-helix	1747-1769	23
α-helix	1776-1795	20
α-helix	1802-1826	25
β-strand	1843-1846	4	207
α-helix	1853-1856	4
β-strand	1857-1861	5	207
β-strand	1864-1867	4	207
α-helix	1883-1897	15
β-strand	1904-1905	2	208
α-helix	1912-1923	12
β-strand	1929-1930	2	209
α-helix	1941-1950	10
β-strand	1954-1957	4	209
α-helix	1965-1983	19
β-strand	1998-2001	4	210
β-strand	2004-2007	4	210
β-strand	2013-2016	4	209
α-helix	2031-2034	4
β-strand	2039-2040	2	208
α-helix	2046-2056	11
α-helix	2063-2079	17
α-helix	2090-2117	28
α-helix	2124-2130	7
α-helix	2133-2143	11
α-helix	2151-2153	3
α-helix	2154-2164	11
α-helix	2176-2188	13
α-helix	2201-2216	16
β-strand	2219-2222	4	211
α-helix	2226-2228	3
α-helix	2230-2244	15
β-strand	2250-2254	5	211
β-strand	2266	1	212
β-strand	2269	1	213
β-strand	2274	1	213
β-strand	2277	1	212
α-helix	2279-2289	11
β-strand	2299-2304	6	211
α-helix	2313-2319	7
β-strand	2324-2327	4	214
β-strand	2331-2334	4	214
β-strand	2341-2344	4	211
α-helix	2353-2358	6
α-helix	2371-2381	11
α-helix	2391-2399	9
α-helix	2411-2427	17
α-helix	2432-2442	11
α-helix	2452-2475	24
α-helix	2480-2482	3
α-helix	2483-2502	20
α-helix	2508-2521	14
β-strand	2537-2539	3	215
β-strand	2545-2547	3	215
α-helix	2548-2551	4
α-helix	2556-2558	3
α-helix	2568-2570	3
α-helix	2572-2587	16
β-strand	2591-2592	2	216
α-helix	2601-2609	9
β-strand	2615-2620	6	216
α-helix	2628-2638	11
β-strand	2639-2644	6	217
β-strand	2647-2652	6	217
β-strand	2658-2663	6	216
α-helix	2670-2671	2
α-helix	2678-2688	11
β-strand	2691-2694	4	218
β-strand	2699-2702	4	218
β-strand	2707-2710	4	216
α-helix	2722-2724	3
α-helix	2725-2728	4
α-helix	2741-2755	15
α-helix	2763-2765	3
α-helix	2766-2778	13
α-helix	2780-2782	3
α-helix	2796-2810	15
α-helix	2818-2832	15
α-helix	2834-2836	3
α-helix	2840-2857	18
α-helix	2863-2866	4
β-strand	2872	1	219
β-strand	2884	1	219
α-helix	2887-2903	17
α-helix	2916-2926	11
β-strand	2933-2936	4	220
α-helix	2946-2953	8
α-helix	2956-2957	2
β-strand	2958-2960	3	221
α-helix	2969-2980	12
α-helix	2981-2986	6
β-strand	2991-2993	3	221
β-strand	3001	1	222
α-helix	3003-3013	11
α-helix	3024-3040	17
α-helix	3047-3056	10
α-helix	3057-3061	5
β-strand	3063	1	221
β-strand	3065	1	220
β-strand	3068	1	220
β-strand	3077	1	222
α-helix	3084-3088	5
β-strand	3090-3093	4	220
α-helix	3099-3107	9
α-helix	3109-3112	4
α-helix	3139-3163	25
α-helix	3173-3297	125
α-helix	3302-3308	7
α-helix	3315-3325	11
α-helix	3335-3343	9
α-helix	3347-3352	6
α-helix	3361-3372	12
α-helix	3375-3377	3
α-helix	3379-3385	7
α-helix	3390-3500	111
α-helix	3504-3515	12
α-helix	3523-3538	16
α-helix	3549-3552	4
α-helix	3556-3564	9
α-helix	3571-3582	12
β-strand	3587-3590	4	223
α-helix	3595-3604	10
β-strand	3611-3612	2	223
α-helix	3620-3625	6
α-helix	3626-3630	5
β-strand	3634-3635	2	223
α-helix	3643-3645	3
α-helix	3646-3649	4
β-strand	3654-3656	3	224
β-strand	3659-3664	6	224
β-strand	3667-3670	4	224
α-helix	3671	1
β-strand	3678-3680	3	223
α-helix	3690-3694	5
β-strand	3697-3700	4	223
α-helix	3705-3720	16
α-helix	3722-3731	10
α-helix	3736-3750	15
α-helix	3767-3785	19
α-helix	3789-3817	29
α-helix	3829-3840	12
α-helix	3844-3846	3
α-helix	3852-3872	21
α-helix	3877-3893	17
α-helix	3902-3910	9
α-helix	3911-3913	3
α-helix	3929-3939	11
α-helix	3947-3953	7
α-helix	3956-3961	6
α-helix	3979-3981	3
α-helix	3982-3996	15
α-helix	3998-4000	3
α-helix	4001-4009	9
α-helix	4024-4025	2
α-helix	4027-4032	6
α-helix	4040	1
β-strand	4041-4045	5	225
α-helix	4052-4062	11
β-strand	4066-4069	4	225
α-helix	4076-4090	15
β-strand	4093-4096	4	225
α-helix	4103-4115	13
β-strand	4124-4129	6	225
α-helix	4136-4140	5
β-strand	4144-4146	3	225
α-helix	4154-4163	10
α-helix	4174-4189	16
α-helix	4192-4194	3
α-helix	4209-4226	18
α-helix	4241-4245	5
α-helix	4246-4250	5
α-helix	4259-4271	13
α-helix	4275-4278	4
β-strand	4288	1	226
β-strand	4292	1	226
α-helix	4302-4309	8
α-helix	4319-4321	3
α-helix	4326-4344	19
α-helix	4376-4390	15
α-helix	4396-4398	3
α-helix	4408-4439	32
α-helix	4446-4456	11
α-helix	4475-4499	25
β-strand	4510	1	227
α-helix	4511-4513	3
α-helix	4517-4530	14
β-strand	4539	1	228
β-strand	4542-4544	3	229
β-strand	4557-4560	4	229
β-strand	4561	1	227
β-strand	4564-4571	8	230
β-strand	4574-4583	10	230
β-strand	4588-4591	4	229
β-strand	4594	1	228
β-strand	4604-4610	7	231
β-strand	4618-4625	8	231
α-helix	4634-4638	5
β-strand	4641-4643	3	230

Chain E: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-15	4	52
β-strand	20-25	6	52
β-strand	33-36	4	52
β-strand	39-42	4	53
β-strand	45-46	2	54
β-strand	57	1	53
α-helix	60-64	5
β-strand	69-72	4	53
β-strand	75-76	2	55
β-strand	79-80	2	55
α-helix	83-93	11
β-strand	108-112	5	52
α-helix	113	1
α-helix	118-130	13
β-strand	136-141	6	52
α-helix	142-150	9
β-strand	155-160	6	30
β-strand	165-171	7	30
β-strand	174-175	2	30
β-strand	181-183	3	30
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	56
α-helix	228-233	6
α-helix	235-236	2
β-strand	240-242	3	57
β-strand	248-250	3	57
α-helix	254-257	4
α-helix	259-261	3
α-helix	265-268	4
α-helix	275-285	11
α-helix	290-296	7
β-strand	298-301	4	30
α-helix	303-306	4
β-strand	308	1	56
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	30
α-helix	339-349	11
α-helix	352-356	5
β-strand	358-359	2	52
α-helix	360-366	7
α-helix	368-373	6

Chain f: 209 helices, 104 β-strands

Element	Residues	Length	Sheet
α-helix	23-26	4
α-helix	29-36	8
α-helix	50-55	6
α-helix	59-69	11
β-strand	77-79	3	232
β-strand	85-86	2	233
β-strand	96-97	2	233
β-strand	103-104	2	232
β-strand	117-118	2	232
α-helix	145-152	8
α-helix	157-167	11
α-helix	178-194	17
α-helix	211-222	12
α-helix	225-227	3
α-helix	229-232	4
α-helix	234-237	4
α-helix	239-261	23
α-helix	271-292	22
α-helix	295-306	12
α-helix	310-314	5
α-helix	315-319	5
α-helix	322-336	15
α-helix	341-345	5
α-helix	350-363	14
α-helix	364-368	5
α-helix	374-399	26
α-helix	406-440	35
α-helix	455-482	28
α-helix	514-532	19
α-helix	540-574	35
α-helix	578-587	10
α-helix	589-591	3
α-helix	595-624	30
α-helix	632-638	7
α-helix	643-668	26
α-helix	677-692	16
α-helix	695-709	15
β-strand	719-723	5	234
β-strand	732-736	5	234
α-helix	741-749	9
α-helix	750-754	5
α-helix	755-756	2
α-helix	762-773	12
α-helix	775-797	23
α-helix	799-802	4
α-helix	808-821	14
α-helix	829-866	38
α-helix	871-889	19
α-helix	896-927	32
β-strand	959-961	3	235
β-strand	963-964	2	236
β-strand	969-970	2	236
α-helix	975-994	20
α-helix	1022-1025	4
α-helix	1031-1062	32
α-helix	1065-1071	7
α-helix	1076-1091	16
β-strand	1099-1102	4	235
β-strand	1105-1108	4	235
α-helix	1110-1155	46
α-helix	1163-1197	35
α-helix	1211-1233	23
α-helix	1236-1264	29
α-helix	1273-1302	30
α-helix	1314-1347	34
β-strand	1350	1	237
α-helix	1351-1353	3
α-helix	1356-1371	16
α-helix	1375-1378	4
α-helix	1381-1403	23
α-helix	1410-1414	5
α-helix	1415-1420	6
β-strand	1430	1	237
α-helix	1431-1435	5
α-helix	1436	1
α-helix	1439-1472	34
β-strand	1478-1480	3	238
β-strand	1484-1486	3	238
α-helix	1490-1509	20
α-helix	1511-1514	4
α-helix	1519-1552	34
α-helix	1556-1560	5
α-helix	1562-1583	22
α-helix	1588-1593	6
α-helix	1597-1624	28
α-helix	1627-1630	4
α-helix	1634-1642	9
α-helix	1665	1
β-strand	1666	1	239
α-helix	1667	1
β-strand	1672	1	240
β-strand	1673	1	239
β-strand	1676	1	241
β-strand	1684	1	241
β-strand	1691	1	240
α-helix	1698-1729	32
α-helix	1735-1743	9
α-helix	1747-1767	21
α-helix	1776-1797	22
α-helix	1802-1827	26
α-helix	1836-1840	5
β-strand	1843-1846	4	242
β-strand	1857-1860	4	242
β-strand	1865-1867	3	242
α-helix	1868	1
α-helix	1883-1895	13
β-strand	1902-1903	2	243
α-helix	1912-1921	10
β-strand	1927-1928	2	244
α-helix	1938-1951	14
β-strand	1954-1955	2	244
β-strand	1956	1	245
α-helix	1960-1962	3
α-helix	1965-1983	19
β-strand	1998-2001	4	246
β-strand	2004-2007	4	246
β-strand	2015	1	245
α-helix	2018-2020	3
β-strand	2037-2038	2	243
α-helix	2046-2056	11
α-helix	2063-2079	17
α-helix	2090-2117	28
α-helix	2124-2129	6
α-helix	2133-2148	16
α-helix	2153-2164	12
α-helix	2176-2188	13
α-helix	2201-2214	14
β-strand	2219	1	247
β-strand	2220-2223	4	248
α-helix	2230-2245	16
β-strand	2250-2253	4	249
α-helix	2261-2264	4
β-strand	2267-2269	3	250
β-strand	2274-2276	3	250
α-helix	2279-2289	11
β-strand	2299-2302	4	249
β-strand	2305	1	251
α-helix	2316-2319	4
β-strand	2325-2327	3	252
β-strand	2331-2333	3	252
β-strand	2341	1	247
β-strand	2342	1	249
β-strand	2344	1	248
β-strand	2345	1	251
α-helix	2353-2358	6
β-strand	2360-2363	4	248
α-helix	2373-2382	10
α-helix	2392-2399	8
α-helix	2411-2427	17
α-helix	2432-2442	11
α-helix	2444-2445	2
α-helix	2451-2475	25
α-helix	2483-2500	18
α-helix	2503-2505	3
α-helix	2508-2521	14
β-strand	2537-2539	3	253
β-strand	2545-2547	3	253
α-helix	2572-2585	14
β-strand	2591-2593	3	254
α-helix	2601-2611	11
β-strand	2615-2619	5	254
α-helix	2628-2638	11
β-strand	2639-2642	4	255
β-strand	2649-2652	4	255
β-strand	2658-2663	6	254
α-helix	2678-2683	6
α-helix	2684-2688	5
β-strand	2692	1	256
β-strand	2701	1	256
β-strand	2706-2711	6	254
α-helix	2725-2728	4
α-helix	2732	1
β-strand	2733-2734	2	254
α-helix	2735	1
α-helix	2740-2755	16
α-helix	2763-2783	21
α-helix	2796-2810	15
α-helix	2818-2828	11
α-helix	2829-2833	5
α-helix	2834-2836	3
α-helix	2840-2857	18
α-helix	2863-2867	5
α-helix	2886-2903	18
α-helix	2913-2925	13
β-strand	2932-2933	2	257
β-strand	2936	1	258
β-strand	2939-2940	2	259
β-strand	2943	1	259
α-helix	2946-2953	8
β-strand	2957	1	260
β-strand	2960	1	257
α-helix	2971-2983	13
β-strand	2990	1	260
β-strand	2992-2995	4	257
α-helix	3005-3014	10
α-helix	3024-3038	15
α-helix	3047-3056	10
α-helix	3057-3061	5
β-strand	3064-3067	4	257
β-strand	3068	1	258
α-helix	3083-3087	5
β-strand	3090	1	257
α-helix	3097-3098	2
α-helix	3099-3111	13
α-helix	3139-3163	25
α-helix	3173-3297	125
α-helix	3302-3309	8
α-helix	3315-3328	14
α-helix	3339-3343	5
α-helix	3347-3350	4
α-helix	3362-3370	9
α-helix	3379-3385	7
α-helix	3389-3498	110
α-helix	3499-3501	3
α-helix	3503-3515	13
α-helix	3522-3527	6
α-helix	3528-3532	5
α-helix	3533-3538	6
α-helix	3549-3553	5
α-helix	3558-3565	8
α-helix	3571-3581	11
β-strand	3588-3591	4	261
α-helix	3595-3603	9
β-strand	3611-3613	3	262
α-helix	3618-3628	11
β-strand	3633-3636	4	262
α-helix	3645-3649	5
β-strand	3654-3656	3	263
β-strand	3659-3661	3	263
β-strand	3662-3664	3	264
β-strand	3667-3669	3	264
β-strand	3677-3679	3	262
β-strand	3680-3682	3	261
α-helix	3690-3694	5
β-strand	3698-3700	3	261
α-helix	3705-3720	16
α-helix	3722-3731	10
α-helix	3736-3753	18
α-helix	3767-3785	19
α-helix	3788-3815	28
α-helix	3829-3840	12
α-helix	3852-3862	11
α-helix	3863-3867	5
α-helix	3868-3872	5
α-helix	3877-3892	16
α-helix	3901-3905	5
α-helix	3906-3910	5
α-helix	3929-3939	11
α-helix	3946	1
α-helix	3947-3952	6
α-helix	3953	1
α-helix	3957-3962	6
β-strand	3967	1	265
β-strand	3969	1	265
α-helix	3982-3994	13
α-helix	3998-4010	13
α-helix	4016-4021	6
α-helix	4027-4032	6
β-strand	4040-4041	2	266
β-strand	4043-4045	3	267
α-helix	4046	1
α-helix	4052-4061	10
β-strand	4066-4070	5	268
α-helix	4074-4090	17
β-strand	4093-4097	5	268
α-helix	4099-4101	3
α-helix	4103-4114	12
β-strand	4124-4125	2	266
β-strand	4126-4127	2	268
β-strand	4128-4129	2	267
α-helix	4136-4139	4
β-strand	4145-4147	3	267
α-helix	4149-4151	3
α-helix	4153-4163	11
α-helix	4166-4170	5
α-helix	4173	1
α-helix	4174-4175	2
α-helix	4176-4180	5
α-helix	4181-4193	13
α-helix	4209-4225	17
α-helix	4240-4249	10
α-helix	4259-4271	13
α-helix	4275-4278	4
β-strand	4281-4288	8	269
β-strand	4292-4297	6	269
α-helix	4302-4311	10
α-helix	4318-4321	4
α-helix	4325-4345	21
α-helix	4376-4390	15
α-helix	4402-4406	5
α-helix	4408-4438	31
α-helix	4446-4456	11
α-helix	4462-4464	3
α-helix	4475-4506	32
β-strand	4509-4510	2	270
α-helix	4511-4513	3
α-helix	4517-4531	15
α-helix	4536-4538	3
β-strand	4539	1	271
β-strand	4542-4546	5	270
α-helix	4551-4553	3
β-strand	4557-4561	5	270
β-strand	4564-4566	3	272
β-strand	4568-4571	4	273
β-strand	4574-4577	4	273
β-strand	4587-4591	5	270
β-strand	4594	1	271
β-strand	4605-4609	5	272
β-strand	4620-4624	5	272
β-strand	4625-4626	2	273
α-helix	4632-4634	3
α-helix	4635-4639	5
β-strand	4641-4643	3	272

Chain F: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-15	4	60
β-strand	20-25	6	60
β-strand	33-36	4	60
β-strand	39-42	4	61
β-strand	45-46	2	62
β-strand	57	1	61
α-helix	60-64	5
β-strand	69-72	4	61
β-strand	75-76	2	63
β-strand	79-80	2	63
α-helix	83-94	12
α-helix	103-105	3
β-strand	108-112	5	60
α-helix	118-130	13
β-strand	136-141	6	60
α-helix	142-150	9
β-strand	155-160	6	44
β-strand	165-171	7	44
β-strand	174-175	2	44
α-helix	177-179	3
β-strand	181-183	3	44
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	64
α-helix	228-233	6
β-strand	240-242	3	65
β-strand	248-250	3	65
α-helix	254-257	4
α-helix	258-262	5
α-helix	265-268	4
α-helix	275-285	11
α-helix	290-296	7
β-strand	298-301	4	44
α-helix	303-306	4
β-strand	308	1	64
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	44
α-helix	339-349	11
α-helix	352-356	5
β-strand	358-359	2	60
α-helix	360-366	7
α-helix	368-373	6

30 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-centractin	A, B, C, D, E, F, G, I	protein	376	Sus scrofa	A0A8D1PMN0 (AlphaFold model)
Actin, cytoplasmic 1	H	protein	375	Sus scrofa	Q6QAQ1 (AlphaFold model)
Actin-related protein 10	J	protein	417	Sus scrofa	I3LHK5 (AlphaFold model)
F-actin-capping protein subunit alpha-1	K	protein	286	Sus scrofa	A0PFK5 (AlphaFold model)
F-actin-capping protein subunit beta	L	protein	272	Sus scrofa	A0PFK7
Dynactin subunit 2	M, N, P, Q	protein	405	Sus scrofa	A0A5G2QD80
Dynactin subunit 3	O, R	protein	186	Sus scrofa	F1SEC0
Dynactin subunit 6	U	protein	190	Sus scrofa	D0G6S1
Dynactin subunit 5	V	protein	182	Sus scrofa	A0A286ZK88
Dynactin subunit 1	W, Z	protein	1281	Sus scrofa	A0A287B8J2
Dynactin subunit 4	Y	protein	467	Sus scrofa	A0A4X1TB62
Cytoplasmic dynein 1 heavy chain 1	e, f, m, n	protein	4646	Sus scrofa	A0A480I0V8

3 more molecules are not listed.

Sequence of entity 1 (A, B, C, D, E, F, G, I), FASTA

>9DGR_1 Alpha-centractin (chains A, B, C, D, E, F, G, I)
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF

Sequence of entity 2 (H), FASTA

>9DGR_2 Actin, cytoplasmic 1 (chains H)
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Sequence of entity 3 (J), FASTA

>9DGR_3 Actin-related protein 10 (chains J)
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERP
SPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLA
ENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Sequence of entity 4 (K), FASTA

>9DGR_4 F-actin-capping protein subunit alpha-1 (chains K)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGSLKSW
RESCDSALRAYVKDHYSNGFCTVYAKNIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSVTVSNEAQTAKEFIKIIEHAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 5 (L), FASTA

>9DGR_5 F-actin-capping protein subunit beta (chains L)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Sequence of entity 6 (M, N, P, Q), FASTA

>9DGR_6 Dynactin subunit 2 (chains M, N, P, Q)
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Sequence of entity 7 (O, R), FASTA

>9DGR_7 Dynactin subunit 3 (chains O, R)
MAGVTDVQRLQARLEELERWVYGPGGSRGSRKVADGLVKVQVALGNIASKRERVKILYKK
IEDLIKYLDPEYMDRIAIPDASKLQFILAEEQFILSQVALLEQVEALVPMLDSAHIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQ
VKPAEE

Sequence of entity 8 (U), FASTA

>9DGR_8 Dynactin subunit 6 (chains U)
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN

Sequence of entity 9 (V), FASTA

>9DGR_9 Dynactin subunit 5 (chains V)
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV

Sequence of entity 10 (W, Z), FASTA

>9DGR_10 Dynactin subunit 1 (chains W, Z)
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLRRE
GTDSNAKTSKLRGPKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEASDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGAQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGIRGPPPSGIATLVSGIAGEEQQRGGAPGQAPGI
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSVLKGAQMKASLAALPPLHVAKLSLPPHE
GPGSELAAGALYRKTNQLLETLNQLSTHTHVVDITRSSPAAKSPSAQLLEQVTQLKSLSD
TIEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLG
QRHRLVLTQEQLHQLHDRLIS

Sequence of entity 11 (Y), FASTA

>9DGR_11 Dynactin subunit 4 (chains Y)
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTN
STAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEG
DVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Sequence of entity 12 (e, f, m, n), FASTA

>9DGR_12 Cytoplasmic dynein 1 heavy chain 1 (chains e, f, m, n)
MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKS
ALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIK
RAPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAP
SVEKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPT
FLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLT
LDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAI
FTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVF
QTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVI
VRVLRPQVTAVAQQNQGEAPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSK
EGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGA
IREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTA
YMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFAI
ESTRVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAIS
LIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETV
FNFQEKVDDLLIIEEKIDLEVRSLETCVYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWV
NKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVH
ELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYR
NALTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQ
ALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMT
EFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQ
RFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLAD
WEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTETGLLSGSEERVQ
VALEELQDLKGVWSELSKIWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQY
ASYEFVQRLLKGYLKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQ
KNEAVVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEH
INSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHL
LPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLE
RERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILSEDNSVVLGISSRE
GEEVTFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYIT
WIDKYQAQLVVLSAQIAWSENVEAALSSIGGSGDSAPLQSVLSNVEVTLNVLADSVLMEQ
PPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQ
MANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALG
HQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQE
ALREHSSPNHDKASAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLA
MTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSA
GNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSL
LSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGL
MMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLF
THVLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVR
IMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKG
KEDEGEEAASPMLQIQRDAATTLQPYFTPNGLVTKALEHAFKLEHIMDLTRLRCLGSLFS
MLHQACRNVAQYNANHPDFPMQMEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRR
ITTVPLPAAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEAL
LYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCE
YRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTW
VKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLVP
SLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEG
LIRIWAHEALRLFQDRLVEDEERRWTDENIDLVALKHFPNIDKEKAMSRPILYSNWLSKD
YIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSG
AGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVL
DSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIR
NLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNY
VVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFI
NHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKL
KKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIK
KQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEIS
DAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLE
DDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLK
SLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQAN
IQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFI
MNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRV
LITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAE
RPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEV
TRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVL
YENPNLKGVTDHTQRLCIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTVGEPT
YEAEFQHFLRGKEIVLSAGSTPKIPGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFSIW
LDSSSPEQTVPHLWSEENPATPIGQAIHRLLLIQAFRPDRLLAMAHVFVSTNLGESFMSI
MEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQA
DKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLR
AGRIFVFEPPPGVKANMLRTFSSVPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLG
WSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEF
DQRLLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSW
LGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTRTDSTADGRPAWMRTL
HTTASNWLHLIPQTLSHLKRTVDNIKDPLFRFFEREVKMGARLLQDVRQDLADVVQVCEG
KKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQSVSQAAASGG
AKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVIVTTSQSATLDACSFGV
TGLKLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTNAEKKANVVTLPVYLNFTRADLIF
TVDFEIATKEDPRSFYERGVAVLCTE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
MG	Magnesium ion	Mg	2

Primary citation

Roles of microtubules and LIS1 in dynein transport machinery assembly. Rao, Q., Yang, J., Chai, P. et al. Nature (2026) 652:1384-1392. DOI 10.1038/s41586-026-10153-y · PubMed

Other PDB entries of the same protein (UniProt A0A8D1PMN0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z8M 3.37 Å, The pointed end complex of dynactin bound to BICDR1
9DGS 3.9 Å, Dynactin and dynein tail region of dynein-dynactin complex on microtubules
9YNG 4.07 Å, Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the…
9DGU 7.1 Å, structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on…
9DGT 7.2 Å, structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on…
9DGV 8.8 Å, structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules

Browse structure collections

About this viewer

MolViewer shows 9DGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.