7Z8M: The pointed end complex of dynactin

The pointed end complex of dynactin bound to BICDR1. Determined by electron microscopy at 3.37 Å resolution. Released 27 Jul 2022.

Method: Electron microscopy
Resolution: 3.37 Å
Organisms: Sus scrofa, Mus musculus
Chains: 9
Atoms: 17,694
Mol. weight: 379.31 kDa
Ligands: ZN, ATP, MG, ADP
Released: 27 Jul 2022

Explore 7Z8M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z8M contains 130 α-helices and 156 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-15	4	19
β-strand	20-25	6	19
β-strand	33-36	4	19
β-strand	39-42	4	20
β-strand	45-46	2	1
β-strand	57	1	20
α-helix	60-64	5
β-strand	69-72	4	20
β-strand	75-76	2	21
β-strand	79-80	2	21
α-helix	83-93	11
β-strand	108-111	4	19
α-helix	118-126	9
α-helix	127-131	5
β-strand	136-140	5	19
α-helix	142-150	9
β-strand	155-160	6	22
β-strand	165-171	7	22
β-strand	174-175	2	22
α-helix	177-179	3
β-strand	181-183	3	22
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	23
α-helix	228-233	6
β-strand	240-242	3	24
β-strand	248-250	3	24
α-helix	254-257	4
α-helix	259-262	4
α-helix	265-268	4
α-helix	275-285	11
α-helix	288-295	8
β-strand	298-301	4	22
α-helix	303-306	4
β-strand	308	1	23
α-helix	310-321	12
α-helix	323	1
β-strand	330-331	2	22
α-helix	339-348	10
α-helix	351-356	6
β-strand	358-359	2	19
α-helix	360-365	6
α-helix	368-374	7

Chain H: 27 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	8-12	5	25
β-strand	16-21	6	25
β-strand	29-32	4	25
β-strand	35-38	4	26
α-helix	44-45	2
β-strand	53-54	2	26
α-helix	56-60	5
β-strand	65-68	4	26
β-strand	71-72	2	27
β-strand	75-76	2	27
α-helix	79-87	9
α-helix	88-94	7
α-helix	98-100	3
β-strand	103-107	5	25
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	25
α-helix	137-144	8
β-strand	150-155	6	28
β-strand	160-166	7	28
β-strand	169-170	2	28
α-helix	172-174	3
β-strand	176-178	3	28
α-helix	183-196	14
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	29
β-strand	247-250	4	29
α-helix	252-254	3
α-helix	259-262	4
α-helix	264-267	4
α-helix	274-284	11
α-helix	287-295	9
β-strand	297-300	4	28
α-helix	302-305	4
α-helix	309-320	12
α-helix	326-327	2
β-strand	329-330	2	28
α-helix	335-337	3
α-helix	338-348	11
α-helix	351-354	4
β-strand	357-358	2	25
α-helix	359-365	7
α-helix	367-369	3
α-helix	370-373	4

Chain I: 24 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	10-11	2
β-strand	12-15	4	34
β-strand	20-25	6	34
β-strand	33-36	4	34
β-strand	39-42	4	35
β-strand	57	1	35
α-helix	60-64	5
α-helix	66-68	3
β-strand	69-72	4	35
β-strand	75-76	2	36
β-strand	79-80	2	36
α-helix	83-93	11
β-strand	95	1	37
β-strand	99	1	37
β-strand	108-112	5	34
α-helix	118-130	13
β-strand	136-141	6	34
α-helix	142-150	9
β-strand	155-160	6	1
β-strand	165-171	7	1
β-strand	174-175	2	1
α-helix	177-179	3
β-strand	181-183	3	1
α-helix	187-201	15
α-helix	208-220	13
β-strand	223	1	38
α-helix	228-233	6
α-helix	235-236	2
β-strand	240-242	3	39
β-strand	248-250	3	39
α-helix	254-257	4
α-helix	260-263	4
α-helix	265-268	4
α-helix	275-285	11
α-helix	288-296	9
β-strand	298-301	4	1
α-helix	303-306	4
β-strand	308	1	38
α-helix	310-321	12
α-helix	323	1
β-strand	329-331	3	1
α-helix	336-338	3
α-helix	339-349	11
α-helix	351-355	5
β-strand	358-359	2	34
α-helix	360-366	7
α-helix	369-373	5

Chain J: 23 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	16-19	4	16
β-strand	24-29	6	16
β-strand	37-40	4	16
β-strand	42-43	2	17
α-helix	51	1
β-strand	52-53	2	17
α-helix	61-74	14
α-helix	75-79	5
β-strand	89-93	5	16
α-helix	99-107	9
α-helix	108-112	5
β-strand	117-122	6	16
α-helix	123-131	9
β-strand	135-141	7	12
β-strand	146-152	7	12
β-strand	155-156	2	12
α-helix	158-160	3
β-strand	162-164	3	12
α-helix	168-181	14
β-strand	185-186	2	18
α-helix	204-213	10
α-helix	217-219	3
α-helix	220-231	12
α-helix	240-245	6
β-strand	246-250	5	18
β-strand	254-258	5	18
α-helix	260-265	6
α-helix	268-271	4
α-helix	280-289	10
α-helix	296-301	6
β-strand	303-306	4	12
α-helix	308-311	4
α-helix	315-327	13
α-helix	330-336	7
β-strand	343	1	12
α-helix	353-362	10
α-helix	365-371	7
β-strand	373-374	2	16
α-helix	375-381	7

Chain M: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	19-21	3	1
α-helix	22-24	3

Chain U: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	2
β-strand	23-24	2	3
β-strand	27-29	3	4
β-strand	35	1	5
β-strand	40-42	3	3
β-strand	48-50	3	4
β-strand	55-56	2	5
β-strand	61-63	3	3
α-helix	81	1
β-strand	82-84	3	4
β-strand	89-90	2	5
β-strand	95	1	6
β-strand	100-101	2	4
β-strand	106-107	2	5
β-strand	112-113	2	6
β-strand	118-119	2	4
β-strand	124-125	2	5
β-strand	130-131	2	6
β-strand	136	1	4
α-helix	137-138	2
β-strand	141-143	3	5
β-strand	151-153	3	5
α-helix	161-174	14
β-strand	177	1	2
α-helix	180-182	3

Chain V: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	8	1	30
α-helix	10-12	3
β-strand	13-15	3	31
β-strand	21-23	3	31
β-strand	27-29	3	32
β-strand	35-36	2	32
β-strand	41-42	2	31
β-strand	47-49	3	32
β-strand	55-57	3	32
β-strand	62-63	2	31
β-strand	68-69	2	32
β-strand	73-74	2	33
β-strand	81-82	2	33
α-helix	83-84	2
β-strand	85-87	3	32
β-strand	92-93	2	31
α-helix	94	1
β-strand	98-104	7	32
β-strand	109-110	2	31
α-helix	111	1
β-strand	114-122	9	32
β-strand	127-128	2	31
β-strand	132-134	3	32
β-strand	139-140	2	32
α-helix	141	1
β-strand	145-147	3	31
β-strand	152-153	2	31
α-helix	161-174	14
α-helix	177	1
β-strand	178	1	30
α-helix	179-180	2

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	347-357	11

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynactin subunit 2	M	protein	405	Sus scrofa	A0A5G2QD80 (AlphaFold model)
BICD family-like cargo adapter 1	X	protein	577	Mus musculus	A0JNT9 (AlphaFold model)
Dynactin 6	U	protein	190	Sus scrofa	D0G6S1 (AlphaFold model)
Dynactin subunit 4	Y	protein	467	Sus scrofa	A0A4X1TB62 (AlphaFold model)
Arp11	J	protein	417	Sus scrofa	I3LHK5
ARP1 actin related protein 1 homolog A	G, I	protein	376	Sus scrofa	A0A8D1PMN0
Actin, cytoplasmic 1	H	protein	375	Sus scrofa	Q6QAQ1
Dynactin subunit 5	V	protein	182	Sus scrofa	A0A286ZK88

Sequence of entity 1 (M), FASTA

>7Z8M_1 Dynactin subunit 2 (chains M)
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDALQEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKMTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNTKGAGSGGKTTSGSPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIACSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK

Sequence of entity 2 (X), FASTA

>7Z8M_2 BICD family-like cargo adapter 1 (chains X)
MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEE
LALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLG
KALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQL
QDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREK
NSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQG
HDKDLQLHQSQLELQEVRLSYRQLQGKVEELTEERSLQSSAATSTSLLSEIEQSMEAEEL
EQEREQLRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRT
ALNDLKRLIQSIVDGVEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQLQKAIRDRDEA
IAKKNAVELELAKCKMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLK
EQSRPAAAAFPRGHGVGRGQEPSTADGKRLFSFFRKI

Sequence of entity 3 (U), FASTA

>7Z8M_3 Dynactin 6 (chains U)
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDSEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN

Sequence of entity 4 (Y), FASTA

>7Z8M_4 Dynactin subunit 4 (chains Y)
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTAVKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPDHPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGTTITALAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRQCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEEGDPDDTN
STAKVSVPPTELVLAGKDAAAEYDELAEPQDFPDDPDVVAFRKANKVGVFIKVTPQREEG
DVTVCFKLKHDFKNLAAPIRPVEEADPGAEVSWLTQHVELSLGPLLP

Sequence of entity 5 (J), FASTA

>7Z8M_5 Arp11 (chains J)
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIKVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTGAAKEQSLPSVMGSIPEGVLEDIKVRTCFVSDLTRGLKIQAAKFNIDGNTERP
SPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLA
ENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMVFDVGKSQPPLMKRAFSTEK

Sequence of entity 6 (G, I), FASTA

>7Z8M_6 ARP1 actin related protein 1 homolog A (chains G, I)
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF

Sequence of entity 7 (H), FASTA

>7Z8M_7 Actin, cytoplasmic 1 (chains H)
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Sequence of entity 8 (V), FASTA

>7Z8M_8 Dynactin subunit 5 (chains V)
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
MG	Magnesium ion	Mg	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	3

Primary citation

Structure of dynein-dynactin on microtubules shows tandem adaptor binding. Chaaban, S., Carter, A.P. Nature (2022) 610:212-216. DOI 10.1038/s41586-022-05186-y · PubMed

Other PDB entries of the same protein (UniProt A0A5G2QD80 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F1U 3.4 Å, N terminal region of dynein tail domains in complex with dynactin filament and BICDR-1
6F1T 3.5 Å, Cryo-EM structure of two dynein tail domains bound to dynactin and BICDR1
6ZNL 3.8 Å, Cryo-EM structure of the dynactin complex
9DGS 3.9 Å, Dynactin and dynein tail region of dynein-dynactin complex on microtubules
9YNG 4.07 Å, Dynactin and dynein-1 tail region of dynein-dynactin complex on microtubule in the…
6ZNM 4.1 Å, The pointed end complex of dynactin bound to BICDR1
6ZNN 4.5 Å, The pointed end complex of dynactin bound to Hook3
9HHL 6.53 Å, Structure of Dynein-Dynactin-NuMA-LIS1
6F38 6.7 Å, Cryo-EM structure of two dynein tail domains bound to dynactin and HOOK3
6ZNO 6.8 Å, The pointed end complex of dynactin with the p150 projection docked
9DGU 7.1 Å, structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on…
9DGT 7.2 Å, structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on…

Browse structure collections

About this viewer

MolViewer shows 7Z8M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.