T4 Lysozyme A73H/G77H/Y139F co-crystallized with Cu(II)-NTA. Determined by X-ray diffraction at 1.11 Å resolution. Released 18 Feb 2026.
Explore 9DJD in 3D Show helices and sheets RCSB PDB PDBe
9DJD contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 | |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 16 | 1 | 2 |
| β-strand | 17-19 | 3 | 1 |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 31-32 | 2 | 1 |
| α-helix | 39-50 | 12 | |
| β-strand | 57 | 1 | 2 |
| α-helix | 60-80 | 21 | |
| α-helix | 84-90 | 7 | |
| α-helix | 93-106 | 14 | |
| α-helix | 108-112 | 5 | |
| α-helix | 115-122 | 8 | |
| α-helix | 126-133 | 8 | |
| α-helix | 137-141 | 5 | |
| α-helix | 143-155 | 13 | |
| α-helix | 159-161 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endolysin | A | protein | 164 | Tequatrovirus T4 | D9IEF7 |
>9DJD_1 Endolysin (chains A) MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK DEAEKLFNQDVDHAVRHILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM LQQKRWDEAAVNLAKSRWFNQTPNRAKRVITTFRTGTWDAYKNL
| ID | Name | Formula | Copies |
|---|---|---|---|
| CU | Copper (II) ion | Cu | 1 |
| NTA | Nitrilotriacetic acid | C6 H9 N O6 | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
| HEZ | Hexane-1,6-diol | C6 H14 O2 | 2 |
Water and common crystallization additives (K, CL) are not listed.
Structural characterization of the Cu(II)-NTA spin label on alpha-helices by X-ray crystallography and electron paramagnetic resonance. Besaw, J.E., Reichenwallner, J., Chen, E.Y. et al. Structure (2026) 34:645-661.e6. DOI 10.1016/j.str.2026.01.010 · PubMed
Other PDB entries of the same protein (UniProt D9IEF7), best resolution first:
MolViewer shows 9DJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.